KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A4519Help
Entry
SNSL254_A4519     CDS       T00739                                 

Gene name
aceB
Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:see00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SNSL254_A4519 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SNSL254_A4519 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    SNSL254_A4519 (aceB)
Enzymes [BR:see01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SNSL254_A4519 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4392194..4393798
Genome map
AA seq 534 aa AA seqDB search
MMNPQATTTDELTFTRPQGELEKQVLTAEAVEFLTELVTRFTPKRNKLLAARIQQQQDID
NGKLPDFISETTSIRESNWQIRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADFE
DSLAPDWNKVIDGQINLRDAVNGTISYTNEAGKIYQLKPDPAVLICRVRGLHLPEKHVTW
RGEAIPGSLFDFALYFFHNYKALLAKGSGPYFYLPKTQAWQEAAWWSEVFSYAEDRFNLP
RGTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQ
VVTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDVERNNQVLAKVKADKALEANN
GHDGTWIAHPGLADTAMAVFNEVLGEHKNQLFITRDEDAPITAEQLLEPCEGERTEAGMR
ANIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHEKTLSNGKPVTKALF
REMLAEEMRVIQDELGEHRYSSGRFDDAARLMEQITTSDDLIDFLTLPGYRLLA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatccacaggcaaccacaactgatgaattaacctttaccaggccgcaaggcgag
ctggaaaagcaagtcctgaccgctgaagcagtcgagtttttgacggagttagtcacccgt
tttacgccaaaacgcaataaactcctggctgcacgtatccagcaacagcaggatattgat
aacggtaagttgcctgattttatttcggaaaccacttccattagagaaagtaattggcag
attcgtggtattccggcggatttacaggatcgccgagtagaaattaccgggccggttgaa
cgtaaaatggtgattaatgccctgaacgcaaacgtgaaagtgtttatggcggattttgaa
gactcgctggcgccggactggaataaagttattgatggtcaaatcaacctgcgtgatgcg
gtgaacggcaccattagctataccaacgaagccggaaaaatctatcagctcaagcccgat
ccggccgtattgatttgtcgtgtacgcggtctacatctgccagaaaaacatgttacctgg
cggggggaagctattcccggcagcctgtttgattttgctctgtactttttccacaactat
aaagcgctgctcgctaaaggtagcggcccgtatttttacctgccgaaaacgcaagcctgg
caggaggcagcctggtggagtgaagttttcagctacgccgaagaccgctttaacctgccg
cgcggtacgatcaaagcgaccctgttgattgaaacgctgccggctgttttccagatggat
gagattcttcatgcgctgcgtgatcatatcgtcggtctcaactgtggtcgctgggattat
attttcagctatatcaaaacgttgaaaaatcacccggatcgcgtcctgccggacaggcag
gtggtaacgatggacaaaccgtttctgagcgcctactcgcgcctgctgatcaaaacctgt
cacaagcgcggcgcgttcgcgatgggcggtatggcggcgtttatcccgagcaaagacgtt
gaacgcaacaatcaggtccttgccaaagtgaaagcggataaagcgctggaagcgaacaac
ggccacgacggcacgtggattgcgcatcccgggttggcggataccgcaatggccgtcttt
aacgaggtactgggcgagcacaaaaatcagctgttcattacccgtgatgaagatgcgccg
attaccgctgaacagttactggagccatgtgaaggcgaacgcacagaagcgggaatgcgc
gccaatattcgcgtggcagtgcagtacattgaagcgtggatctccggcaatggctgtgta
ccgatttacggtctgatggaggatgccgcgacggcggaaatctcacgaacctctatctgg
cagtggattcaccatgagaaaacactgagcaatggaaaacccgtaacgaaagcgcttttc
cgcgaaatgttggcggaagagatgcgggtaatccaggacgagctgggcgagcaccgctac
agcagcgggcgcttcgacgatgccgcacgtctgatggagcaaatcaccacctcagatgac
ttaatcgacttcctcaccctgccgggctatcgcttactggcttaa

DBGET integrated database retrieval system