KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A4644Help
Entry
SNSL254_A4644     CDS       T00739                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:see00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SNSL254_A4644
  Lipid metabolism
   00561 Glycerolipid metabolism
    SNSL254_A4644
   00600 Sphingolipid metabolism
    SNSL254_A4644
Enzymes [BR:see01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     SNSL254_A4644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4533499..4534854
Genome map
AA seq 451 aa AA seqDB search
MMTAPKITFIGAGSTIFVKNILGDVFHREALKSAHVALMDIDETRLEESHIVVRKLMDSA
GASGRITCHTNQKAALQDADFVVVAFQIGGYEPCTVTDFEVCKRHGLEQTIADTLGPGGI
MRALRTIPHLWRICEDMTEVCPKATMLNYVNPMAMNTWAMYARYPHIKQVGLCHSVQGTA
EELARDLNIDPASLRYRCAGINHMAFYLELERKTADGTYVDLYPELLAAYDAGQAPKPNI
HGNERCQNIVRYEMFKKLGYFVTESSEHFAEYTPWFIKPGREDLIARYKVPLDEYPKRCV
EQLANWHKELEEYKTAERIDIKPSREYASTIMNALWTGEPSVIYGNVRNEGLIDNLPQGS
CVEVACLVDANGIQPTKVGTIPSHLAAMMQTNINVQTLLTEAILTENRDRVYHAAMMDPH
TAAVLGIEEIYALVDDLIAAHGDWLPAWLRR
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgatgacggcacccaaaattacctttatcggcgcaggttctacgattttcgtcaaaaat
atcctcggcgatgtgtttcaccgcgaggcgctaaagtcagcgcatgtcgccctgatggat
attgacgaaacccggctggaagagtcgcacattgtggtacggaaactgatggactcagcg
ggcgcttctggccggattacctgccataccaaccagaaagcggcgctacaggatgcggat
ttcgtggtggtcgcctttcagattggcggctatgaaccctgcaccgtgaccgattttgag
gtttgtaagcgtcatggcctggaacagacgatcgccgatacgctggggccgggcggcatc
atgcgcgcgctgcggaccatcccgcatctgtggcggatttgcgaagacatgacggaagtc
tgtccgaaggccaccatgctcaattacgtcaacccgatggcgatgaatacctgggcgatg
tatgcccgctatccgcatatcaaacaggtcggcctgtgccattcggtacagggaacagcg
gaagaactggcgcgcgacctgaatatcgatcccgcctcgctgcgctaccgctgcgccggc
attaaccacatggcgttttacctggaactggagcgcaaaacggctgacgggacttatgtc
gatctctatcctgaattgctggcggcctatgacgccggacaggcgccgaagcccaatatt
cacggcaatgaacgctgccagaacattgtgcgctatgagatgttcaaaaagttgggctac
ttcgtcactgagtcatcagagcattttgccgagtacacgccgtggtttattaaaccggga
cgcgaggatctgattgcgcgctacaaggtgccgctggatgaatatccgaaacgctgcgta
gaacaactggcgaactggcataaagagctggaggagtataaaaccgccgagcgtatcgac
atcaaaccgtcccgcgagtacgccagcaccattatgaacgctctgtggaccggcgagccg
agcgtgatttacggcaatgtgcgtaatgaggggctgattgataacctgccgcagggaagc
tgcgtggaagtggcttgtctggtggatgccaacggcattcaaccgacgaaggtggggacg
atcccttctcatctggcggcgatgatgcagaccaacatcaacgtgcaaacgctgttgacc
gaagccatcctcacggaaaaccgcgatcgcgtgtatcacgcggcgatgatggaccctcat
accgcagcggtgctgggtatcgaagaaatctatgcgttggttgacgatctgatcgccgcg
catggcgactggcttccggcctggttacgccgttaa

DBGET integrated database retrieval system