KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_A4913Help
Entry
SNSL254_A4913     CDS       T00739                                 

Gene name
holD
Definition
DNA polymerase III subunit psi (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:see00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SNSL254_A4913 (holD)
   00240 Pyrimidine metabolism
    SNSL254_A4913 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SNSL254_A4913 (holD)
   03430 Mismatch repair
    SNSL254_A4913 (holD)
   03440 Homologous recombination
    SNSL254_A4913 (holD)
Enzymes [BR:see01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     SNSL254_A4913 (holD)
DNA replication proteins [BR:see03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     SNSL254_A4913 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4782478..4782915
Genome map
AA seq 145 aa AA seqDB search
MTSRRDWQLQQLGITQWALRRPGALQGEIAISLPAHVRLIVVAEELPALNEPLMRDILRA
LTVSPDQVLPLAPERVAMLPQGSRCNSWRLGTDAPLQLEGAQVTTPAFNELRANPAARAA
LWQQICEHEHDFYPQHDRSPRSLAD
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggtattacgcagtgggcgctgcga
cgtcctggcgcgctacagggcgagattgcgatttcccttcccgcgcacgttcgtctgatc
gtggttgcagaggaattacccgcgctgaacgagccgctaatgcgcgatattttacgcgcg
ttgaccgtgagtcccgatcaggttttacccctggcgcctgagcgcgtcgccatgctgccg
cagggcagccgttgtaatagctggcggttaggaactgacgcgccgctccaactcgaaggc
gctcaggtcacgacgccggcgtttaatgaactccgggcaaacccggcggcacgcgccgca
ctatggcaacaaatctgcgaacatgaacacgatttctatcctcagcacgaccgatctccc
cgcagcctggcagattga

DBGET integrated database retrieval system