KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_p_0094Help
Entry
SNSL254_p_0094    CDS       T00739                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
pSN254:80816..81523
Genome map
AA seq 235 aa AA seqDB search
MRTKLLGALMVFGIITGTAHASSKLEITDPRAAKIEDIVELPIKGVRAVQSDGQIMFLSE
NGRFVISGQIYDLWSKKPLNTMSQMRDVAERIHFKSMGMDVDTLNTVSMGRGDKEVVVFV
DPRCAVCHQLMGDAKSLVDDYTFKFIVIPALGAESNRLAKNLYCAKDKTHALDALMNNTL
GSLPSKETCDPGQYDQTLLTAHFIGIEGVPFVVAPDGRVSKGRPKNLKSWLESAE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcggacaaaattacttggggcgctgatggtgttcgggattattaccggcacggctcat
gcgtcatcgaaattggaaatcaccgatcccagagcggcgaagatagaggacattgtagag
ctacccatcaaaggggttcgagccgtccaaagtgatgggcagatcatgttcctctctgaa
aacggacgatttgttatttcaggacaaatctacgacctgtggagcaagaagcccctcaac
acgatgtcccaaatgagggatgtagcggagcgtatccacttcaagagcatgggcatggat
gtggacacgctgaacactgtgtcgatggggcgtggtgacaaagaggtggtggtctttgtt
gatcctaggtgcgcggtttgccatcagctcatgggtgatgccaaatcgctggtggatgat
tacacctttaaatttatcgtgattccagctctgggtgctgagtccaaccgcctggcaaaa
aacttgtactgcgcgaaagacaaaacccacgcgcttgatgcgctgatgaacaacaccctg
ggttcccttccttcaaaagaaacctgcgaccccggccaatacgaccaaacgctgctgaca
gctcatttcattgggattgagggcgttccgttcgttgttgctccggatggtcgtgtcagc
aaaggacgtccgaagaacctgaaatcatggttggagagtgctgaatga

DBGET integrated database retrieval system