KEGG   Salmonella enterica subsp. enterica serovar Newport SL254: SNSL254_p_0164Help
Entry
SNSL254_p_0164    CDS       T00739                                 

Gene name
merB
Definition
alkylmercury lyase (EC:4.99.1.2)
Orthology
K00221  
alkylmercury lyase [EC:4.99.1.2]
Organism
see  Salmonella enterica subsp. enterica serovar Newport SL254
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
pSN254:complement(144704..145342)
Genome map
AA seq 212 aa AA seqDB search
MKLAPYILERLTSVNRTNGTADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQA
TSTEYDKDGNIIGYGLTLRETSYVFEIDDRRLYAWCALDTLIFPALIGRTARVSSHCAAT
GAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCCHVHFFASVPTAEDWASKHQG
LEGLAIVSVHEAFGLGQEFNRHLLQTMSSRTP
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcgccccatatattttagaacgtctcacttcggtcaatcgtaccaatggtact
gcggatctcttggtcccgctactgcgggaactcgccaaggggcgtccggtttcacgaacg
acacttgccgggattctcgactggcccgctgagcgagtggccgccgtactcgaacaggcc
accagtaccgaatatgacaaagatgggaacatcatcggctacggcctcaccttgcgcgag
acttcgtatgtctttgaaattgacgaccgccgtctgtatgcctggtgcgcgctggacacc
ttgatatttccggcgctgatcggccgtacagctcgcgtctcatcgcattgcgctgcaacc
ggagcacccgtttcactcacggtttcacccagcgagatacaggctgtcgaacctgccggc
atggcggtgtccttggtattgccgcaggaagcagccgacgttcgtcagtccttctgttgc
catgtacatttctttgcatctgtcccgacggcggaagactgggcctccaagcatcaagga
ttggaaggattggcgatcgtcagtgtccacgaggctttcggcttgggccaggagtttaat
cgacatctgttgcagaccatgtcatctaggacaccgtga

DBGET integrated database retrieval system