KEGG   Salmonella enterica subsp. enterica serovar Bareilly: SEEB0189_005025Help
Entry
SEEB0189_005025   CDS       T02739                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
seeb  Salmonella enterica subsp. enterica serovar Bareilly
Pathway
seeb00071  Fatty acid degradation
seeb00280  Valine, leucine and isoleucine degradation
seeb00310  Lysine degradation
seeb00362  Benzoate degradation
seeb00380  Tryptophan metabolism
seeb00620  Pyruvate metabolism
seeb00630  Glyoxylate and dicarboxylate metabolism
seeb00640  Propanoate metabolism
seeb00650  Butanoate metabolism
seeb00900  Terpenoid backbone biosynthesis
seeb01100  Metabolic pathways
seeb01110  Biosynthesis of secondary metabolites
seeb01120  Microbial metabolism in diverse environments
seeb01130  Biosynthesis of antibiotics
seeb01200  Carbon metabolism
seeb01212  Fatty acid metabolism
seeb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:seeb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SEEB0189_005025
   00630 Glyoxylate and dicarboxylate metabolism
    SEEB0189_005025
   00640 Propanoate metabolism
    SEEB0189_005025
   00650 Butanoate metabolism
    SEEB0189_005025
  Lipid metabolism
   00071 Fatty acid degradation
    SEEB0189_005025
   00072 Synthesis and degradation of ketone bodies
    SEEB0189_005025
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SEEB0189_005025
   00310 Lysine degradation
    SEEB0189_005025
   00380 Tryptophan metabolism
    SEEB0189_005025
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SEEB0189_005025
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SEEB0189_005025
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SEEB0189_005025
Enzymes [BR:seeb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SEEB0189_005025
Exosome [BR:seeb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SEEB0189_005025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGQ58090
Position
954443..955651
Genome map
AA seq 402 aa AA seqDB search
MAVSFCAEVVMKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAIDE
VILGQVLTAGAGQNPARQSAIKGGLPTTVSAITINDVCGSGLKALHLATQAIQCGEADIV
IAGGQENMSRAPHVLNDSRSGALPDADNLVDSLVHDGLWDAFNDYHIGVTAENLAREYGI
SRELQDAYALSSQQKARAAIDTGRFKDEIVPIVTQRNGQTAIVDTDEQPRADASAEGLAL
LHPAFDSLGSVTAGNASSINDGAAAVMMMSEAKAQALGLPVLARIRAFASVGVDPALMGI
APVYATRRCLERAGWQLTEVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPI
GASGCRILVSLVHEMVKRDARKGLATLCIGGGQGVALTIERD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgtcattttgcgctgaggtggtaatgaaagaggttgtgatagtgggggcttta
cggacacccatcggctgttttcagggaacgctggcccgtcattccgccgtcgagctgggg
agcatggtcgtaaaagcgttaattgagcgcaccggcgtggacgctaacgctatcgatgag
gtcatcctcggtcaggtactgacggctggcgccgggcagaatccggcgcgccagtcagcc
atcaaaggagggctgccgactaccgtttccgccattaccattaatgacgtttgtggttcc
ggtttaaaagcgttgcacctggcgacgcaggctattcagtgcggcgaagcggacattgtt
attgcgggcgggcaggagaatatgagccgtgcgccgcatgtcctcaatgacagccgtagc
ggcgcgttgcctgatgccgacaatctggtggatagtctggtacatgatggcttatgggat
gccttcaacgattatcacattggcgtgacggcagaaaacctggcgcgggaatatggcatc
agccgcgagttacaggatgcttatgcgctcagttcgcagcaaaaagccagggccgcgatt
gataccggacgttttaaagatgagattgtccccatcgtcacgcaacgtaatgggcagacc
gcaattgtcgatacggatgaacaaccgcgggccgacgccagtgcggaggggttagccctg
ctgcatccggcgtttgatagtttaggttcggtgacggcgggtaatgcctcctcaatcaac
gatggcgccgccgcggtgatgatgatgagcgaggcgaaagcccaggcgctggggctgccg
gtgctggcgcgcatccgcgcgtttgccagcgtcggcgtcgatcctgcgctaatggggatt
gcgccggtatatgctacccggcgctgtctggagcgtgccggctggcaactgacggaggtc
gaccttatcgaagccaacgaagcgtttgccgcccaggcgttgtcggtaggaaaaatgctg
gaatgggatgagcgacgggtaaacgttaatggcggcgcgattgcgctggggcatcccatt
ggcgcttccggttgtcgaattctggtttcactggtgcacgaaatggttaaacgcgacgcg
cgaaaaggtctggcgacgctgtgtatcggtggcggccagggcgttgctttaaccattgaa
cgcgactga

DBGET integrated database retrieval system