KEGG   Salmonella enterica subsp. enterica serovar Bareilly: SEEB0189_00910Help
Entry
SEEB0189_00910    CDS       T02739                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
seeb  Salmonella enterica subsp. enterica serovar Bareilly
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:seeb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SEEB0189_00910
Enzymes [BR:seeb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SEEB0189_00910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
102420..103340
Genome map
AA seq 306 aa AA seqDB search
MDIAVIGSNMVDLITYTNQMPKEGETLEAPAFKIGCGGKGANQAVAAAKLNSKVLMLTKV
GDDIFADNTIRNLESWGINTTYVEKVPCTSSGVAPIFVNANSSNSILIIKGANKFLSPED
IDRAAEDLKKCQLIVLQLEVQLETVYHAIEFGKKHGIKVLLNPAPALRELDMSYACKCDF
FVPNETELEILTGMPVDTYDHIRAAARSLVDKGLNNIIVTMGEKGALWMTRDQEVHVPAF
RVNAVDTSGAGDAFIGCFAHYYVQSGDVEAAMKKAVLFAAFSVTGKGTQSSYPSIEQFNE
YLSLNE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgcggttattggctctaacatggtggaccttatcacctacaccaaccagatg
cccaaagaaggggaaactctggaagcgccggcgtttaaaatcggctgcggcggaaaaggg
gcgaaccaggccgtggcggccgctaagctcaattcaaaagtattgatgttgaccaaagtg
ggcgacgatatttttgccgacaacaccattcgtaatctcgaatcctgggggatcaatacg
acgtatgtagaaaaagtaccgtgtaccagcagcggcgtagcgccgattttcgtcaacgcc
aactccagcaacagcattctgatcatcaaaggtgctaacaagtttctctcgccggaagat
atcgatcgcgcggcggaagatttaaaaaaatgccagcttattgttctgcaactggaagtt
cagcttgaaacggtttatcacgcaatagaatttggcaagaaacacgggattaaagtgtta
ttaaaccctgcgccagcattacgggaattagatatgtcttatgcctgtaaatgcgatttc
tttgtacccaatgaaaccgagctggaaatattaaccggtatgccagtggatacctatgac
catattcgcgcagcggcacgttcgctggtggataaagggctgaacaatattatcgtcacc
atgggtgagaaaggcgcgctgtggatgacgcgtgaccaggaagtccatgtcccggcgttt
agagtgaacgctgtcgataccagcggcgcgggcgatgcctttatcggctgtttcgcgcat
tactacgtccagagcggggatgtggaagccgccatgaaaaaagccgtcctctttgccgct
ttcagcgtcaccgggaaaggcacccaatcctcttatccaagcattgaacaatttaatgag
tatctttcgttgaacgaataa

DBGET integrated database retrieval system