KEGG   Salmonella enterica subsp. enterica serovar Bareilly: SEEB0189_02305Help
Entry
SEEB0189_02305    CDS       T02739                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
seeb  Salmonella enterica subsp. enterica serovar Bareilly
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seeb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SEEB0189_02305 (malQ)
Enzymes [BR:seeb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SEEB0189_02305 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
420460..422538
Genome map
AA seq 692 aa AA seqDB search
MENKRLDSAALAAGISPSYINAHGKPQSIGAETKRRLLAAMHGTTTGPQAVVPNVKVYTA
GKKMALPVEGRGEFAWLLTTEEGVHYKGRVTGGKKLNLPATLPEGYHTLTLTQDEQRTHC
RIIVAPPRCYEPQALLEGKKLWGACVQLYTLRSEKNWGIGDFGDLKSMLVDVATRGGAFI
GLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFRLSEEAQAWWQMPATQQKLR
QARDAQWVDYATVTALKITALRMAWTRFAARDDAQMAEFRHFIAREGESLYWQAAFDALH
AYQVKEDEQRWGWPAWPEAYQSVESPAVKQFCEAHREEVEFYLWLQWLAWRQFAACWDTC
QSFKLPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMDPHI
IVARAYEPFIDLLRANMQNCGALRIDHVMSLLRLWWIPYGETADQGAYVHYPVDDLLSIL
ALESQRHRCMVIGEDLGTVPVEIVGKLRDSGVYSYKVLWFENDLEKNFRAPGAYPQQSMA
VASTHDLPTLRGYWECGDLTLGKALGLYPDEVILRGLYEDRERAKQGLLDALHKYGCLPK
RAGHKASLMSMTPTLNRGLQRYIADSNSGLLGLQPEDWLDMADPVNVPGTSDQYKNWRRK
LSASLEAMFADEGVNKLIKDLDKRRKAAAKKK
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataaacgtctcgatagtgccgcgctggcggcggggatcagccccagttacatc
aatgctcatggcaaaccgcagtctattggcgctgaaaccaagagacgtttgctggcggcg
atgcacggcacgacaacaggaccacaggcggtcgtgccgaatgtgaaggtttataccgcg
ggtaaaaaaatggcgttgccggtagaggggcgcggtgagtttgcctggctgctgactacg
gaagagggcgtgcattacaaagggcgcgtgacgggcggtaaaaaacttaacctgccggct
acgttgccggagggctaccacaccctgacgttgacccaggatgaacagcgtacgcactgc
cgtattatcgtcgccccgccgcgatgctatgagccgcaggcgctgctggaagggaaaaaa
ctgtggggggcctgcgtccagctttatactctgcgttcagaaaaaaactggggtattggc
gatttcggcgatttgaagtcgatgctggtcgacgtggcgacacgcggcggcgcgtttatc
ggcctgaatccgatccacgcgctttatccggcgaatccggagagcgccagtccctacagc
ccttcgtctcgtcgctggctgaacgtgatatatatcgacgtcaacgccgtcgaagatttc
cgcctgagcgaagaggcgcaggcatggtggcaaatgcccgccacacagcaaaagctgcga
caggcgcgcgatgcgcaatgggtggattacgctaccgttaccgcgctgaaaatcacggcg
ctgcggatggcgtggacgcggtttgccgctcgcgacgatgcgcaaatggcggagtttcgt
cactttatcgcccgcgaaggcgagagcctttactggcaggcggcattcgacgcgctgcat
gcgtatcaggtaaaagaggatgagcagcgctggggctggccagcctggccggaggcgtac
cagtcggtagagtctcccgcggtaaaacaattctgtgaagcgcaccgcgaagaggtggag
ttttacctctggcttcagtggctggcctggcgccaattcgccgcctgctgggatacctgc
cagagttttaaactaccgattggtctgtaccgcgatctggcggttggcgtagcggaaggc
ggcgcggaaacctggtgcgaccgggagctgtactgcctgaaagcatctgtcggcgcgccg
ccggatatcctcggcccgctcggtcagaactgggggttgccgccaatggacccgcatatc
attgtcgcccgggcgtatgagccctttatcgacctgctgcgcgccaatatgcaaaactgc
ggcgcgttgcgcattgaccatgtcatgtctttgctgcgtctgtggtggataccgtatggc
gaaacagcggatcagggggcttacgtccattatccggtagatgatttgctttctattctg
gcgctggagagccaacgtcaccgctgtatggtgataggcgaagatctggggacggtgcca
gttgagattgtcggcaagctgcgcgatagcggggtctattcttataaagtgctgtggttt
gaaaatgaccttgagaaaaacttccgcgcgccaggcgcgtatccgcaacaatcgatggct
gtcgcctcgacgcacgatctccccacgctgcgcggctattgggaatgcggtgacctgacg
ttgggtaaagctctggggctttatccggatgaagtgattctgcgcgggctgtatgaggat
cgcgagcgggcgaaacaggggctgttggacgcgctgcataaatatggctgtctgccaaaa
cgcgccgggcataaggcatcgttaatgtcgatgacgccaacgctaaatcgcgggcttcag
cgctacatcgccgacagtaacagcggtctgttggggcttcagccggaggactggctggat
atggccgatccggttaacgtaccgggcaccagcgatcagtataaaaactggcggcggaaa
ttgtctgcatctcttgaggccatgtttgccgatgagggcgtaaacaagctgattaaggat
ttggataagcgccgaaaagcggccgcgaagaagaagtaa

DBGET integrated database retrieval system