KEGG   Salmonella enterica subsp. enterica serovar Bareilly: SEEB0189_15670Help
Entry
SEEB0189_15670    CDS       T02739                                 

Definition
2-oxoglutarate dehydrogenase E1
Orthology
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
seeb  Salmonella enterica subsp. enterica serovar Bareilly
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:seeb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SEEB0189_15670
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SEEB0189_15670
  Amino acid metabolism
   00310 Lysine degradation
    SEEB0189_15670
   00380 Tryptophan metabolism
    SEEB0189_15670
Enzymes [BR:seeb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     SEEB0189_15670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3186527..3189328)
Genome map
AA seq 933 aa AA seqDB search
MQNSALKAWLDSSYLSGSNQSWIEQLYEDFLTDPDSVDANWRLTFQQLPGTGVKPDQLHS
KTREYFRRQALAGSRHSSTISDPDTNVKQVKVLQLINAYRFRGHQHANLDPLGLWKQERV
ADLDPSFHDLTEADFQETFNVGSFASGKETMKLGELLDALKQTYCGPIGAEYMHITSTEE
KRWIQQRIESGRAAFSADEKKRFLNELTAAEGLERYLGAKFPGAKRFSLEGGDALIPMLK
EMVRHAGNSGTREVVLGMAHRGRLNVLINVLGKKPQDLFDEFAGKHKEHLGTGDVKYHMG
FSSDIETEGGLVHLALAFNPSHLEIVSPVVMGSVRARLDRLDEPSSNKVLPITIHGDAAV
TGQGVVQETLNMSKARGYEVGGTVRIVINNQVGFTTSNPLDARSTPYCTDIGKMVQAPIF
HVNADDPEAVAFVTRLALDFRNTFKRDVFIDLVCYRRHGHNEADEPSATQPLMYQKIKKH
PTPRKIYADKLEADKVATLEDATEMVNLYRDALDAGECVVKEWRPMNMHSFTWSPYLNHE
WDEAYPNKVEMKRLQELAKRISTVPEAIEMQSRVAKIYGDRQAMAAGEKLFDWGGAENLA
YATLVDEGIPVRLSGEDSGRGTFFHRHAVIHNQTNGSTYTPLQHIHSGQGQFKVWDSVLS
EEAVLAFEYGYATAEPRTLTIWEAQFGDFANGAQVVIDQFISSGEQKWGRMCGLVMLLPH
GYEGQGPEHSSARLERYLQLCAEQNMQVCVPSTPAQVYHMLRRQALRGMRRPLVVMSPKS
LLRHPLAVSTLDELANGSFQPAIGEIDELDPKAVKRVVMCSGKVYYDLLEQRRKNDQKDV
AIVRIEQLYPFPHKAVQEALQPYAHVHDFVWCQEEPLNQGAWYCSQHHFREVIPFGAALR
YAGRPASASPAVGYMSVHQKQQQDLVNDALNVD
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacagcgctttgaaagcctggttggactcttcttacctctctggttcgaatcag
agctggatagaacagctctatgaagacttcttaaccgatcctgactcggtagacgctaac
tggcgtttgacgttccagcagttacctggtaccggagtcaaaccggatcaactccattca
aaaacacgtgaatatttccggcggcaggcgttggctggctcacgtcactcttctacgatt
tccgaccctgacaccaatgtgaagcaggttaaagtcctgcagcttatcaacgcttatcgt
ttccgtggccatcagcatgcaaacctcgatccgctgggactgtggaagcaagaacgcgtg
gcggatctggacccttctttccatgatttgaccgaggccgatttccaggaaaccttcaat
gtcggctcctttgccagcggcaaagagacgatgaagctgggcgagctgctcgacgcgctc
aaacagacctactgcggcccgattggcgctgagtatatgcacatcaccagcaccgaagag
aaacgctggatccaacagcgcatcgaatccggtcgtgcggcctttagcgctgacgagaaa
aaacgcttcctgaacgaactgaccgccgctgaagggctggaacgttatctgggcgccaaa
ttcccgggtgcgaaacgtttctcgcttgaggggggagatgcgctgatacccatgctgaaa
gagatggttcgccatgcgggtaacagcggcactcgcgaagtggtgctggggatggcgcac
cgcggtcgcctgaacgtgctgatcaacgtactgggtaaaaaaccgcaggatctgttcgac
gagtttgccggtaaacataaagaacatctgggtaccggcgacgtgaagtatcacatgggc
ttctcgtcagatatcgaaaccgaaggcggtctggttcacctggcgctggcgtttaaccca
tcgcacctggaaattgtgagcccggtggtgatgggctccgtgcgtgcccgtctggaccga
ctggacgaaccgagcagcaacaaagtgttgccgatcactattcacggcgacgccgcggtg
accggccagggcgtagttcaggaaaccctgaacatgtcgaaagcgcgcggttacgaagtg
ggcggtacggtacgtatcgttatcaacaaccaggtgggcttcaccacctctaacccactg
gatgcgcgttcaacgccttactgcaccgatatcggtaaaatggtccaggcgccgattttc
cacgtcaacgcggacgatccggaagccgtcgcttttgtgacccgtctggcgctggacttc
cgtaatacctttaaacgcgatgtctttatcgatctggtgtgctaccgccgtcacggccac
aacgaagccgacgagccaagcgcaacccagccgctgatgtaccagaaaatcaaaaagcat
ccgacgccgcgtaaaatctacgccgacaaactggaagctgataaggtcgcaacgctggaa
gatgccaccgaaatggtcaacctctatcgcgatgcgctggatgcaggcgaatgcgtggtg
aaagagtggcgtccgatgaatatgcactcgttcacctggtcgccgtatctaaaccacgaa
tgggatgaagcatacccgaacaaggtagaaatgaagcgtctgcaggagctggcaaaacgt
atcagcaccgtgccggaagccattgaaatgcagtctcgcgtggcgaaaatttatggcgac
cgtcaggcaatggcggcaggcgagaaattgtttgactggggcggcgcggaaaatctggct
tacgccacgctggtcgatgaaggcattccggtgcgcctgtccggggaagactccggtcgc
ggcaccttcttccatcgtcatgcggtgatccacaaccagacgaacggctcaacgtatacg
ccgttgcagcatattcacagcggtcagggacagtttaaagtctgggactccgtgctgtct
gaagaagcggtactggcttttgaatacggttatgccacggcggaaccacgtaccctgact
atctgggaagcgcagtttggcgattttgccaacggcgcgcaggtagtgattgaccagttc
atctcctccggcgagcagaaatggggccggatgtgcggtctggtgatgctgttgccgcac
ggctatgaagggcagggcccggagcactcctccgcgcgtctggaacgttatctgcaactt
tgcgccgagcagaatatgcaggtttgcgtgccgtccaccccggcgcaggtctaccatatg
ctgcgccgtcaggcgctgcgcgggatgcgtcgtccgctggtggtgatgtcgccgaaatcg
ctgctgcgtcacccgctggcggtttccacgcttgatgaactggcgaacggttccttccag
ccggccattggcgaaattgacgagctggaccctaaagccgtaaaacgcgtggtaatgtgt
tctggtaaggtttattacgacctgctggaacaacgtcgcaaaaacgaccagaaagatgtc
gctatcgtgcgcatcgaacagctctatccgttcccgcataaagcggtgcaggaagcgctg
caaccatacgctcacgtccatgattttgtctggtgccaggaagagccgctcaaccagggc
gcatggtactgcagtcagcatcatttccgtgaagtgattccgtttggggccgctctgcgt
tatgcaggtcgcccggcctccgcctctccggcggtagggtatatgtccgttcaccagaaa
cagcaacaagatctggttaatgacgcgctgaacgtcgattaa

DBGET integrated database retrieval system