KEGG   Salmonella enterica subsp. enterica Serovar Cubana: CFSAN002050_01840Help
Entry
CFSAN002050_01840 CDS       T02734                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
seec  Salmonella enterica subsp. enterica Serovar Cubana
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:seec00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CFSAN002050_01840
Enzymes [BR:seec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CFSAN002050_01840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(62218..63138)
Genome map
AA seq 306 aa AA seqDB search
MDIAVIGSNMVDLITYTNQMPKEGETLEAPAFKIGCGGKGANQAVAAAKLNSKVLMLTKV
GDDIFADNTIRNLESWGINTTYVEKVPCTSSGVAPIFVNANSSNSILIIKGANKFLSPED
IDRAAEDLKKCQLIVLQLEVQLETVYHAIEFGKKHGIEVLLNPAPALRELDMSYACKCDF
FVPNETELEILTGMPVDTYDHIRAAARSLVDKGLNNIIVTMGEKGALWMTRDQEVHVPAF
RVNAVDTSGAGDAFIGCFAHYYVQSGDVEAAMKKAVLFAAFSVTGKGTQSSYPSIEQFNE
YLSLNE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgcggttattggctctaacatggtggaccttatcacctacaccaaccagatg
cccaaagaaggggaaactctggaagcgccggcgtttaaaatcggctgcggcggaaaaggg
gcgaaccaggccgtggcggccgctaagctcaattcaaaagtattgatgttgaccaaagtg
ggcgacgatatttttgccgacaacaccattcgtaatctcgaatcctgggggatcaatacg
acgtatgtagaaaaagtaccgtgtaccagcagcggcgtagcgccgattttcgtcaacgcc
aactccagcaacagcattctgatcatcaaaggcgccaacaagtttctctcgccggaagat
atcgatcgcgcggcggaagatttaaaaaaatgccagcttattgttctgcaactggaagtt
cagcttgaaacggtttatcacgcaatagaatttggcaagaaacatgggattgaagtgtta
ttaaaccctgcgccagcattacgggaattagatatgtcttatgcctgtaaatgcgatttc
tttgtacccaatgaaaccgagctggaaatattaaccggtatgccagtggatacctatgac
catattcgcgcagcggcacgttcgctggtggataaagggctgaacaatattatcgtcacc
atgggtgagaaaggcgcgctgtggatgacgcgtgaccaggaagtccatgtcccggcgttt
agagtgaacgctgtcgataccagcggcgcgggcgatgcctttatcggctgtttcgcgcat
tactacgttcagagcggggatgtggaagccgccatgaaaaaagccgtcctctttgctgct
ttcagcgtcaccgggaaaggcacccaatcctcttatccaagcattgagcaatttaatgag
tatctttctttgaacgaataa

DBGET integrated database retrieval system