KEGG   Salmonella enterica subsp. enterica Serovar Cubana: CFSAN002050_02310Help
Entry
CFSAN002050_02310 CDS       T02734                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
seec  Salmonella enterica subsp. enterica Serovar Cubana
Pathway
seec00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:seec00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CFSAN002050_02310
Enzymes [BR:seec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CFSAN002050_02310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase Aldolase
Motif
Other DBs
NCBI-ProteinID: AGQ71375
UniProt: S5HQD2
Position
160784..161713
Genome map
AA seq 309 aa AA seqDB search
MKTAGNLIVLGSINADHILNLESFPTPGETVTGSHYQVAFGGKGANQAVAAGRSGANIAF
IACTGDDDIGDSIRKQLVSDRIDIAPVSVIKGESTGVALIFVNGEGENVIGIHAGANAAL
SPALVDAQRERIAQADALLMQLESPLESVLAAAKIAHQHHTTVALNPAPARELPDELLAL
VDIITPNETEAEKLTGVRVENDDDAAKAAQVLHDKGIRTVLITLGSRGVWASVNGEGRRV
PGFSVEAVDTIAAGDTFNGAFITAILEETPLPEAIRFAHAAAAIAVTRKGAQPSVPWREE
IEAFLHQQG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgcaggtaatctcatcgtccttggcagcattaatgccgatcatatccttaat
cttgagtccttccctaccccgggtgaaacggtaaccggtagccattatcaggtcgcgttt
ggcgggaaaggcgcgaatcaggcggttgctgcgggacgtagcggggcaaatattgcgttt
atcgcctgcacgggcgatgacgatattggcgacagtattcgtaaacaattagtcagcgat
cgtattgatatcgcgccagttagcgttattaaaggcgagtctaccggggtggcgctgatt
ttcgttaacggcgaaggcgagaacgtcatcggtattcatgccggagcgaatgccgcgtta
tcgccggcgttggttgatgcgcagcgtgaacgtatcgcgcaggcggatgcgttactgatg
cagctggaatcgccgctggaaagcgtactggcggcggcgaaaatcgcccatcaacatcat
actactgttgcgcttaacccggcgcctgcccgtgagctaccggatgaactgctggcgctg
gtggacatcatcacgccaaatgaaacggaagctgaaaagctgacgggcgtgcgtgtggaa
aatgacgacgatgccgcgaaagctgcgcaggttttgcatgataaaggcattcgaaccgta
ttaattaccttaggaagccgtggcgtctgggccagcgtaaacggcgagggccgccgcgtt
cctggatttagcgttgaggctgtcgataccattgccgccggagatacgtttaacggcgcc
tttatcaccgcgatactggaggagacgccgttgccggaagcgattcgctttgcccatgcc
gccgccgcgattgccgtaacgcgtaaaggcgcgcaaccttccgttccgtggcgcgaagag
atagaagcgtttttacatcagcaggggtaa

DBGET integrated database retrieval system