KEGG   Salmonella enterica subsp. enterica Serovar Cubana: CFSAN002050_10230Help
Entry
CFSAN002050_10230 CDS       T02734                                 

Definition
2-oxoglutarate dehydrogenase E1
Orthology
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
seec  Salmonella enterica subsp. enterica Serovar Cubana
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:seec01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:seec00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:seec00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:seec00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1815836..1818637
Genome map
AA seq 933 aa AA seqDB search
MQNSALKAWLDSSYLSGSNQSWIEQLYEDFLTDPDSVDANWRLTFQQLPGTGVKPDQLHS
KTREYFRRQALAGSRHSSTISDPDTNVKQVKVLQLINAYRFRGHQHANLDPLGLWKQERV
ADLDPSFHDLTEADFQETFNVGSFASGKETMKLGELLDALKQTYCGPIGAEYMHITSTEE
KRWIQQRIESGRAAFSADEKKRFLNELTAAEGLERYLGAKFPGAKRFSLEGGDALIPMLK
EMVRHAGNSGTREVVLGMAHRGRLNVLINVLGKKPQDLFDEFAGKHKEHLGTGDVKYHMG
FSSDIETEGGLVHLALAFNPSHLEIVSPVVMGSVRARLDRLDEPSSNKVLPITIHGDAAV
TGQGVVQETLNMSKARGYEVGGTVRIVINNQVGFTTSNPLDARSTPYCTDIGKMVQAPIF
HVNADDPEAVAFVTRLALDFRNTFKRDVFIDLVCYRRHGHNEADEPSATQPLMYQKIKKH
PTPRKIYADKLEADKVATLEDATEMVNLYRDALDAGECVVKEWRPMNMHSFTWSPYLNHE
WDEAYPNKVEMKRLQELAKRISTVPEAIEMQSRVAKIYGDRQAMAAGEKLFDWGGAENLA
YATLVDEGIPVRLSGEDSGRGTFFHRHAVIHNQTNGSTYTPLQHIHSGQGQFKVWDSVLS
EEAVLAFEYGYATAEPRTLTIWEAQFGDFANGAQVVIDQFISSGEQKWGRMCGLVMLLPH
GYEGQGPEHSSARLERYLQLCAEQNMQVCVPSTPAQVYHMLRRQALRGMRRPLVVMSPKS
LLRHPLAVSTLDELANGSFQPAIGEIDELDPKAVKRVVMCSGKVYYDLLEQRRKNDQKDV
AIVRIEQLYPFPHKAVQEALQPYAHVHDFVWCQEEPLNQGAWYCSQHHFREVIPFGAALR
YAGRPASASPAVGYMSVHQKQQQDLVNDALNVD
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacagcgctttgaaagcctggttggactcttcttacctctctggttcgaatcag
agctggatagaacagctctatgaagacttcttaaccgatcctgactcggtagacgctaac
tggcgtttgacgttccagcagttacctggtaccggagtcaaaccggatcaactccattca
aaaacacgtgaatatttccggcggcaggcgttggctggctcacgtcactcttctacgatt
tccgaccctgacaccaatgtgaagcaggttaaagtcctgcagcttatcaacgcttatcgt
ttccgtggccatcagcatgcaaacctcgatccgctgggactgtggaaacaagaacgcgtg
gcggatctggacccttctttccatgatttgaccgaggccgatttccaggaaaccttcaat
gtcggctcctttgccagcggcaaagagacgatgaagctgggcgagctgctcgacgcgctc
aaacagacctactgcggcccgattggcgctgagtatatgcacatcaccagcaccgaagag
aaacgctggatccaacagcgcatcgaatccggtcgtgcggcttttagcgctgacgagaaa
aaacgcttcctgaacgaactgaccgccgctgaagggctggaacgttatctgggtgccaaa
ttcccgggtgcgaaacgtttctcgctcgaggggggagatgcgttgatacccatgctgaaa
gagatggttcgccatgcgggtaacagtggcactcgcgaagtggtgctggggatggcgcac
cgcggtcgcctgaacgtgctgatcaacgtactgggtaaaaaaccgcaggatctgttcgac
gaatttgccggtaagcataaagaacatctgggtaccggcgacgtgaagtatcacatgggc
ttctcgtcagatatcgaaaccgaaggcggtctggttcacctggcgctggcgtttaaccca
tcgcatctggaaattgtgagcccggtggtgatgggctccgtgcgcgcccgtctggacaga
ctggacgaaccgagcagcaacaaagtgttgccgatcactattcacggcgacgccgcggtg
accggccagggcgtggttcaggaaaccctgaacatgtcgaaagcgcgcggttacgaagtg
ggcggtacggtacgtatcgttatcaacaaccaggtgggtttcaccacctctaacccactg
gatgcgcgttcaacgccttactgcaccgatatcggtaaaatggtccaggcgccgattttc
cacgtcaatgcggacgatccggaagccgtcgcttttgtgacccgtctggcgctggacttc
cgtaacacctttaaacgtgatgtgttcatcgatctggtgtgctaccgccgtcacggccac
aacgaagctgacgagccaagcgcaacccagccgctgatgtaccagaaaatcaaaaagcat
ccgacgccgcgtaaaatctacgccgacaaactggaagctgataaggtcgcaacgctggaa
gatgccaccgaaatggtcaacctctatcgcgatgcgctggatgcaggcgaatgcgtggtg
aaagagtggcgtccgatgaatatgcactcgttcacctggtcgccgtatctaaaccacgaa
tgggatgaagcatacccgaacaaggtagaaatgaagcgtctgcaggagctggcaaaacgt
atcagcaccgtgccggaagccattgaaatgcagtctcgcgtggcgaaaatttatggcgac
cgtcaggcaatggcggcaggcgagaaattgtttgactggggcggtgcggaaaatctggct
tacgccacgctggtcgatgaaggcattccggtgcgcctgtccggggaagactccggtcgc
ggcaccttcttccatcgtcatgcggtgatccacaaccagacgaacggctcaacgtatacg
ccgttgcagcatattcacagcggtcagggacagtttaaagtctgggactccgtgctgtct
gaagaagcggtactggcttttgaatacggttatgccacggcggaaccacgtaccctgact
atctgggaagcgcagtttggcgattttgccaacggcgcgcaggtagtgattgaccagttc
atctcctccggcgagcagaaatggggccggatgtgcggtctggtgatgctgttgccgcat
ggctatgaagggcagggcccggagcactcctccgcgcgtctggaacgttatctgcaactt
tgcgccgagcagaatatgcaggtttgcgtgccgtccaccccggcgcaggtctaccatatg
ctgcgccgtcaggcgctgcgcgggatgcgtcgtccgctggtggtgatgtcgccgaaatcg
ctgctgcgtcacccgctggcggtttccacgcttgatgaactggcgaacggttccttccag
ccggccattggcgaaattgacgagctggaccctaaagccgtaaaacgcgtggtaatgtgt
tctggtaaggtttattacgacctgctggaacaacgtcgcaaaaacgaccagaaagatgtc
gctatcgtgcgcatcgaacagctctatccgttcccgcataaagcggtgcaggaagcgctg
caaccatacgctcacgtccatgattttgtctggtgccaggaagagccgctcaaccagggc
gcatggtactgcagccagcatcatttccgtgaagtgattccgtttggggccgctctgcgt
tatgcaggtcgcccggcctccgcctctccggcggtagggtatatgtccgttcaccagaaa
cagcaacaagatctggttaatgacgcgctgaacgtcgattaa

DBGET integrated database retrieval system