KEGG   Salmonella enterica subsp. enterica Serovar Cubana: CFSAN002050_10675Help
Entry
CFSAN002050_10675 CDS       T02734                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
seec  Salmonella enterica subsp. enterica Serovar Cubana
Pathway
seec00010  Glycolysis / Gluconeogenesis
seec00071  Fatty acid degradation
seec00350  Tyrosine metabolism
seec00620  Pyruvate metabolism
seec00625  Chloroalkane and chloroalkene degradation
seec00626  Naphthalene degradation
seec00650  Butanoate metabolism
seec01100  Metabolic pathways
seec01110  Biosynthesis of secondary metabolites
seec01120  Microbial metabolism in diverse environments
seec01130  Biosynthesis of antibiotics
seec01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:seec00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CFSAN002050_10675
   00620 Pyruvate metabolism
    CFSAN002050_10675
   00650 Butanoate metabolism
    CFSAN002050_10675
  Lipid metabolism
   00071 Fatty acid degradation
    CFSAN002050_10675
  Amino acid metabolism
   00350 Tyrosine metabolism
    CFSAN002050_10675
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CFSAN002050_10675
   00626 Naphthalene degradation
    CFSAN002050_10675
Enzymes [BR:seec01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     CFSAN002050_10675
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CFSAN002050_10675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 HTH_AsnC-type DUF3235
Motif
Other DBs
NCBI-ProteinID: AGQ72624
UniProt: S5HFI0
Position
1904805..1907474
Genome map
AA seq 889 aa AA seqDB search
MTFAAASCGGASLFPFEVSMSINSIEELNALVARVKKAQRQYASFTQQQVDKIFRAAALA
AADARIPLAKMAVAESGMGIVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIA
EPVGIICGIVPTTNPTSTAIFKSLISLKTRNAIIFSPHPRAKEATNKAADIVLQAAIAAG
APKDLIGWIDQPSVELSNALMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVI
DETADIKRAVASILMSKTFDNGVICASEQSVVVVDSVYDAVRERFAKCGAVILNKKERKA
VGGVLLKNGALNAAIVGQSAATIAEIAGIFVPENSKVLIGEVSATDVSEPFAHEKLSPTL
AMYRAKDFADAVDKAEQLVAMGGIGHTSCLYTDQDNQPERVAYFGQMMKTARILINTPAS
QGGIGDLYNFKLAPSLTLGCGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIY
FRRGSLPIALDEVITDGHKRALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPT
LSVVRKGAELANSFKPDVIIALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIY
KFPKMGVKAKMIAVTTTSGTGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMD
MPKSLCAFGGLDAVTHALEAYVSVLASEFSDGQALQALKLLKENLPTSYHEGSRNPVARE
RVHSAATIAGIAFANAFLGVCHSMAHKLGSQFHIPHGLANALLICNVIRYNANDNPTKQT
AFSQYDRPQARRRYAEIADHLGLSAPGDRTAAKIEKLLAWLESIKVELGIPKSIREAGVQ
EADFLAHVDKLSEDAFDDQCTGANPRYPLVSELRQLLLASFYGEAFAEQ
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgactttcgccgccgcgtcctgcggcggcgcttctctgtttccgtttgaggtttccatg
tcgattaattccattgaagaattaaacgcgctggttgcgcgcgtcaaaaaagcccagcgt
cagtacgcgagtttcacgcaacaacaggtagacaaaatcttccgcgccgccgctctggcc
gccgctgatgcccgcattccgctggccaaaatggcggtcgccgaatctggtatgggcatc
gtagaagacaaagtgattaaaaaccacttcgcttccgaatatatctataacgcctataaa
gatgaaaagacctgcggcgtgctgtcagaagacgacactttcgggaccattacgattgct
gagcctgtcggtattatttgcggtatcgttccaaccactaacccgacctctaccgcgatt
ttcaagtcgctgattagcctgaaaacgcgtaacgccatcatcttttctccgcatccgcgc
gctaaagaggcaaccaacaaagcggcagatatcgttctgcaagcggcaatcgctgccggc
gcgccgaaagatctgattggctggatcgatcaaccttccgtagaactgtctaacgcgctg
atgcaccacccggatattaacctgatccttgcgacgggtggtccaggcatggtgaaagca
gcatacagctccggtaaacctgctatcggcgtaggcgcaggtaacactccggtagtgatt
gatgaaactgctgacattaaacgcgctgtggcgtcaatcctgatgtcgaaaaccttcgat
aacggcgtaatctgtgcttctgaacagtctgttgtcgttgttgattccgtctacgatgcc
gtgcgcgagcgttttgcgaaatgcggcgcggtgattctgaataaaaaagagaggaaagct
gtaggcggagtattgcttaaaaatggggcgctgaatgcggcaattgtcggccagtcagcg
gctacaatcgcagagattgccggcatttttgtgcctgaaaacagcaaggttctgataggg
gaggtgagtgcaacggacgtctctgagcctttcgctcacgaaaaactctctccgacgctc
gccatgtaccgagcaaaagattttgccgatgcggtagataaagcggagcaactggtcgca
atgggcggtatcggccatacctcctgcctgtacactgaccaggataaccagccagaacgc
gttgcttacttcggtcagatgatgaaaacagcgcgtatcctgatcaacaccccggcctct
cagggtggtatcggcgacctgtacaacttcaaactcgcaccttccctgacgttgggttgt
ggttcctggggtggtaactccatctctgaaaacgttggtccgaaacacctgatcaacaag
aaaaccgttgctaagcgagctgaaaacatgttgtggcacaaacttccgaaatctatctac
ttccgccgtggctctttgcccatcgcgctggatgaagtgattactgatggccacaaacgt
gcgctcatcgtgactgaccgcttcctgttcaacaacggctatgcagaccagatcacctct
gtgctgaaagcggctggcgttgaaaccgaagtcttcttcgaagttgaagccgacccgacg
ctttccgttgtgcgcaaaggcgctgagctggctaactccttcaaaccggacgtgattatc
gcgctgggcggtggttccccgatggacgccgcgaaaatcatgtgggtcatgtacgaacat
ccggaaactcacttcgaagagctggcgctgcgctttatggacatccgtaaacgtatctac
aagttcccgaaaatgggcgtgaaagcgaaaatgatcgccgtcaccaccacttccggtacc
ggttctgaagtcacaccgtttgcggttgtgaccgacgatgcaaccggtcagaaatatccg
ctggctgactatgccctgaccccggatatggcgattgtcgacgccaacctggtgatggat
atgccgaagtccctgtgtgcgttcggtggtctggatgcggtaactcacgccctggaagct
tacgtttccgtactggcttctgagttctctgacggtcaggctctgcaggccctgaaactg
ctgaaagaaaacctgccgacgtcttaccacgaagggtctaggaacccggttgcgcgtgaa
cgtgttcacagtgcagcgactatcgccggtatcgcgtttgccaacgccttcctcggtgta
tgtcactccatggcgcacaaactgggctctcagttccacattccgcacggtctggcgaac
gccctgctgatttgtaacgttatccgctacaacgcgaatgacaacccgaccaagcagacc
gctttcagccagtacgatcgtccgcaggcacgccgtcgttacgctgaaattgctgaccac
ctgggcctgagcgcgccgggcgaccgtaccgccgctaagattgaaaaactgctggcatgg
ctggaaagcattaaagttgagctgggcattcctaagtctatccgtgaagcaggcgtgcag
gaagctgacttcctggcacacgttgacaaactgtctgaagatgccttcgatgaccagtgc
accggcgctaacccgcgttatccgctggtatcggaactgcgccaactgctgttggcaagt
ttctacggcgaggcgtttgctgaacaataa

DBGET integrated database retrieval system