KEGG   Salmonella enterica subsp. enterica Serovar Cubana: CFSAN002050_12990Help
Entry
CFSAN002050_12990 CDS       T02734                                 

Gene name
katE
Definition
hydroperoxidase II (EC:1.11.1.6)
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
seec  Salmonella enterica subsp. enterica Serovar Cubana
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:seec00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CFSAN002050_12990 (katE)
  Amino acid metabolism
   00380 Tryptophan metabolism
    CFSAN002050_12990 (katE)
Enzymes [BR:seec01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     CFSAN002050_12990 (katE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2360724..2362976)
Genome map
AA seq 750 aa AA seqDB search
MSHNEKSPHQSPVHDTRESQPGLDSLAPSDGSHRPTPEPTPPGAQPTAPGSLKAPETAND
KLTALDTFRKGSENYALTTNQGVRIADDQNSLRAGSRGPTLLEDFILREKITHFDHERIP
ERIVHARGSAAHGYFQPYKDLSDITKAAFLCDPQKITPVFVRFSTVQGGAGSADTVRDIR
GFATKFYTEEGIFDLVGNNTPIFFIQDAHKFPDFVHAVKPEPHWAIPQGQSAHDTFWDYV
SLQPETLHNVMWAMSDRGIPRSYRTMEGFGIHTFRLINAQGKATFVRFHWKPLAGKASLV
WDESQKLTGRDPDFHRRDLWEAIEAGDFPEYELGLQLIAEEDEFKFDFDLLDPTKLIPEE
LVPVQRVGKMMLNRNPDNFFAENEQAAFHPGHIVPGIDFTNDPLLQGRLFSYTDTQISRL
GGPNFHEIPINRPTCPYHNFQRDGMHRMDIDTNPANYEPNSINDNWPRETPPAPKRGGFE
SYQERVDGNKIRERSPSFGEYYSHPRLFWLSQTPIEQQHIIDAFSFELGKVARAYIRERV
VDQLAHIDVTLAQGVAHNLGFALTHEQTQIAPPPDVNGLKKDPALSLYAVPDGDVKGRVV
AILLNDKVNAADLLTILQALKAKGVHAKLLYSRMGEVTADDGSTLTIAATFAGAPSLTVD
AVIVPCGNIADIESCGDARYYLLEAYKHLKPIALAGDARRFKALLNIDSQGEEGLVEADN
VDHHFMDTLLTLMAAHRVWSRAGKINAIPA
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcataatgagaaatccccccatcagtcccccgtgcatgatacccgtgaatcacag
cccggcctggactccctggcgccgtcagacggttcacatcgccccacgccagaaccgacg
ccgccgggcgcgcaaccaacggcccccggcagcttaaaagcgcccgagaccgcgaatgat
aagctcaccgccctcgacacctttcgtaaaggcagcgaaaattatgcgctgaccaccaat
cagggtgtgcgcatcgccgacgatcaaaattctcttcgcgccggcagccgtggccctacg
ctgttggaagattttatcctgcgcgagaaaattacccactttgaccatgagcgtatcccg
gagaggatcgttcacgcccgcggatcagcagcgcacggctatttccagccatataaagac
ctgagcgacatcacgaaagccgcgtttctgtgcgatccacagaaaattaccccggtcttt
gttcgcttttcgacagtacagggcggcgcggggtctgctgataccgtacgtgatatccgc
ggttttgcgaccaaattttataccgaagagggaattttcgatctcgtcggtaataacacg
ccgatcttttttatccaggatgcgcataagtttccggattttgtgcacgccgttaagccc
gaaccacattgggctattccgcaaggacagagcgcgcacgacaccttctgggactatgtt
tccttacagcctgagacgctgcacaacgtcatgtgggcaatgtcggatcgcggtattcca
cggagttatcggacgatggaagggttcggcattcacaccttccgtctgatcaatgcacaa
gggaaagcgacctttgtccgtttccactggaaaccgttggcaggtaaagcctcgctggta
tgggatgagtcacaaaaactgaccggtcgcgatccggattttcaccgcagggatctgtgg
gaggccatcgaagcgggcgatttcccggaatacgagctgggcctacaactcattgccgaa
gaggatgaatttaaattcgattttgatctgctcgatccgaccaaactgattccggaagag
ttggtgccagtacaacgcgtcggcaaaatgatgttaaaccgtaacccggataactttttc
gctgaaaacgaacaggcggcatttcatccaggacatattgttcccggtattgattttacc
aacgatccgctgttacaggggcgtctgttctcttataccgacacgcaaatcagccgtctg
ggcgggccaaacttccacgaaattccgattaaccgccctacctgcccctaccataacttc
cagcgtgacggtatgcaccggatggatatcgacaccaatccggcgaactatgaaccgaac
tccattaatgacaactggccgcgcgaaacgccgccagcgccaaaacgcggcggcttcgaa
tcataccaggaacgcgtggatggcaataaaatccgcgaacgcagcccctctttcggtgaa
tattactcgcatcctcgcctgttctggctcagtcagacgccgatagaacagcagcatatt
attgacgcgttcagctttgaactgggtaaagtcgcccgcgcgtatattcgggagcgggtg
gtcgatcagttagcgcatattgatgtcacgctggctcagggcgtcgcgcataatctcggt
tttgcactcacccatgagcaaacgcaaattgccccgcctcctgatgtcaacggtctgaaa
aaagatccggcgctcagcctgtatgcggtgccggacggcgatgttaaaggccgcgtggtc
gctatcctgctgaacgataaggttaacgccgccgatctgctgaccattttgcaggcttta
aaagccaaaggcgtccacgcaaaactgctctattcacggatgggtgaagtaacggctgat
gacggttcaacattaactattgcggcaacctttgccggcgcgccgtcgctaacggtcgat
gcggtaatagtaccgtgcggcaatattgccgatatcgagagttgcggcgatgcccgttac
taccttctggaagcctacaaacatctgaagcccatcgcactggcaggcgacgcccgacgg
tttaaggcgcttttaaacattgatagccagggggaagaaggacttgttgaggcagataac
gttgaccaccactttatggacactctgctgacgctgatggcggcacaccgtgtctggtcg
cgtgcggggaaaattaacgcgattcctgcataa

DBGET integrated database retrieval system