KEGG   Salmonella enterica subsp. enterica Serovar Cubana: CFSAN002050_12990Help
Entry
CFSAN002050_12990 CDS       T02734                                 

Gene name
katE
Definition
(GenBank) hydroperoxidase II
  KO
K03781  catalase [EC:1.11.1.6]
Organism
seec  Salmonella enterica subsp. enterica Serovar Cubana
Pathway
seec00380  Tryptophan metabolism
seec00630  Glyoxylate and dicarboxylate metabolism
seec01110  Biosynthesis of secondary metabolites
seec01130  Biosynthesis of antibiotics
seec01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:seec00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CFSAN002050_12990 (katE)
  Amino acid metabolism
   00380 Tryptophan metabolism
    CFSAN002050_12990 (katE)
Enzymes [BR:seec01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     CFSAN002050_12990 (katE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI
Motif
Other DBs
NCBI-ProteinID: AGQ72976
UniProt: S5HKN1
Position
complement(2360724..2362976)
Genome map
AA seq 750 aa AA seqDB search
MSHNEKSPHQSPVHDTRESQPGLDSLAPSDGSHRPTPEPTPPGAQPTAPGSLKAPETAND
KLTALDTFRKGSENYALTTNQGVRIADDQNSLRAGSRGPTLLEDFILREKITHFDHERIP
ERIVHARGSAAHGYFQPYKDLSDITKAAFLCDPQKITPVFVRFSTVQGGAGSADTVRDIR
GFATKFYTEEGIFDLVGNNTPIFFIQDAHKFPDFVHAVKPEPHWAIPQGQSAHDTFWDYV
SLQPETLHNVMWAMSDRGIPRSYRTMEGFGIHTFRLINAQGKATFVRFHWKPLAGKASLV
WDESQKLTGRDPDFHRRDLWEAIEAGDFPEYELGLQLIAEEDEFKFDFDLLDPTKLIPEE
LVPVQRVGKMMLNRNPDNFFAENEQAAFHPGHIVPGIDFTNDPLLQGRLFSYTDTQISRL
GGPNFHEIPINRPTCPYHNFQRDGMHRMDIDTNPANYEPNSINDNWPRETPPAPKRGGFE
SYQERVDGNKIRERSPSFGEYYSHPRLFWLSQTPIEQQHIIDAFSFELGKVARAYIRERV
VDQLAHIDVTLAQGVAHNLGFALTHEQTQIAPPPDVNGLKKDPALSLYAVPDGDVKGRVV
AILLNDKVNAADLLTILQALKAKGVHAKLLYSRMGEVTADDGSTLTIAATFAGAPSLTVD
AVIVPCGNIADIESCGDARYYLLEAYKHLKPIALAGDARRFKALLNIDSQGEEGLVEADN
VDHHFMDTLLTLMAAHRVWSRAGKINAIPA
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcataatgagaaatccccccatcagtcccccgtgcatgatacccgtgaatcacag
cccggcctggactccctggcgccgtcagacggttcacatcgccccacgccagaaccgacg
ccgccgggcgcgcaaccaacggcccccggcagcttaaaagcgcccgagaccgcgaatgat
aagctcaccgccctcgacacctttcgtaaaggcagcgaaaattatgcgctgaccaccaat
cagggtgtgcgcatcgccgacgatcaaaattctcttcgcgccggcagccgtggccctacg
ctgttggaagattttatcctgcgcgagaaaattacccactttgaccatgagcgtatcccg
gagaggatcgttcacgcccgcggatcagcagcgcacggctatttccagccatataaagac
ctgagcgacatcacgaaagccgcgtttctgtgcgatccacagaaaattaccccggtcttt
gttcgcttttcgacagtacagggcggcgcggggtctgctgataccgtacgtgatatccgc
ggttttgcgaccaaattttataccgaagagggaattttcgatctcgtcggtaataacacg
ccgatcttttttatccaggatgcgcataagtttccggattttgtgcacgccgttaagccc
gaaccacattgggctattccgcaaggacagagcgcgcacgacaccttctgggactatgtt
tccttacagcctgagacgctgcacaacgtcatgtgggcaatgtcggatcgcggtattcca
cggagttatcggacgatggaagggttcggcattcacaccttccgtctgatcaatgcacaa
gggaaagcgacctttgtccgtttccactggaaaccgttggcaggtaaagcctcgctggta
tgggatgagtcacaaaaactgaccggtcgcgatccggattttcaccgcagggatctgtgg
gaggccatcgaagcgggcgatttcccggaatacgagctgggcctacaactcattgccgaa
gaggatgaatttaaattcgattttgatctgctcgatccgaccaaactgattccggaagag
ttggtgccagtacaacgcgtcggcaaaatgatgttaaaccgtaacccggataactttttc
gctgaaaacgaacaggcggcatttcatccaggacatattgttcccggtattgattttacc
aacgatccgctgttacaggggcgtctgttctcttataccgacacgcaaatcagccgtctg
ggcgggccaaacttccacgaaattccgattaaccgccctacctgcccctaccataacttc
cagcgtgacggtatgcaccggatggatatcgacaccaatccggcgaactatgaaccgaac
tccattaatgacaactggccgcgcgaaacgccgccagcgccaaaacgcggcggcttcgaa
tcataccaggaacgcgtggatggcaataaaatccgcgaacgcagcccctctttcggtgaa
tattactcgcatcctcgcctgttctggctcagtcagacgccgatagaacagcagcatatt
attgacgcgttcagctttgaactgggtaaagtcgcccgcgcgtatattcgggagcgggtg
gtcgatcagttagcgcatattgatgtcacgctggctcagggcgtcgcgcataatctcggt
tttgcactcacccatgagcaaacgcaaattgccccgcctcctgatgtcaacggtctgaaa
aaagatccggcgctcagcctgtatgcggtgccggacggcgatgttaaaggccgcgtggtc
gctatcctgctgaacgataaggttaacgccgccgatctgctgaccattttgcaggcttta
aaagccaaaggcgtccacgcaaaactgctctattcacggatgggtgaagtaacggctgat
gacggttcaacattaactattgcggcaacctttgccggcgcgccgtcgctaacggtcgat
gcggtaatagtaccgtgcggcaatattgccgatatcgagagttgcggcgatgcccgttac
taccttctggaagcctacaaacatctgaagcccatcgcactggcaggcgacgcccgacgg
tttaaggcgcttttaaacattgatagccagggggaagaaggacttgttgaggcagataac
gttgaccaccactttatggacactctgctgacgctgatggcggcacaccgtgtctggtcg
cgtgcggggaaaattaacgcgattcctgcataa

DBGET integrated database retrieval system