KEGG   Salmonella enterica subsp. enterica Serovar Cubana: CFSAN002050_15215Help
Entry
CFSAN002050_15215 CDS       T02734                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
seec  Salmonella enterica subsp. enterica Serovar Cubana
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seec00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CFSAN002050_15215
Enzymes [BR:seec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CFSAN002050_15215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2821190..2821807)
Genome map
AA seq 205 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAK
LFNQNTSLFEEIRAESARQTIHCVLVDESQFLTRQQVYQLSEVVDKLDIPVLCYGLRTDF
RGELFVGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQDGRPYNEGEQVVIGGNERYVS
VCRKHYKDALEEGSLTAIQERHRHI
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcacagctatatttctactattcggcaatgaatgcgggtaagtcgactgcactgctg
caatcttcatacaattatcaggaacgcgggatgcgtaccgtcgtatatacggcggaaatc
gacgatcgtttcggcgcaggcaaagtcagctctcgtatcggtttgtcgtcgccggcaaaa
ttgtttaaccaaaatacatccttgtttgaagagattcgtgccgagagcgcgcggcagaca
atacattgcgtgttagtcgacgaaagccagtttttgactcgccagcaggtttatcaatta
tccgaggttgtcgacaaattagatattccagtactttgctatgggctacgaacagacttt
cgtggggagctctttgtcggcagccaatacttgctggcatggtcagataagctggtggaa
ttaaaaactatctgtttctgcggtcgtaaagccagtatggttctgcgccttgatcaggac
ggcaggccttataacgaaggcgaacaggtggttattggcgggaatgaacgctacgtttca
gtttgccgtaagcattataaggacgcgctggaggagggctcactgacggcgattcaggag
cgtcatcggcacatatga

DBGET integrated database retrieval system