KEGG   Salmonella enterica subsp. enterica Serovar Cubana: CFSAN002050_16630Help
Entry
CFSAN002050_16630 CDS       T02734                                 

Definition
alpha-amylase (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
seec  Salmonella enterica subsp. enterica Serovar Cubana
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seec00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CFSAN002050_16630
Enzymes [BR:seec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CFSAN002050_16630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3067004..3068488
Genome map
AA seq 494 aa AA seqDB search
MKNPTLLQYFHWYYPDGGKLWSELAERADGLNDIGINMVWLPPACKGASGGYSVGYDTYD
LFDLGEFDQKGTIATKYGDKRQLLTAIDALKKNNIAVLLDVVVNHKMGADEKERIRVQRV
NQDDRTQIDDNIIECEGWTRYTFPARAGQYSNFIWDYHCFSGIDHIENPDEDGIFKIVND
YTGDGWNDQVDDELGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTHCDGFRLDAVKHI
PAWFYKEWIEHVQAVAPKPLFIVAEYWSHEVDKLKTYIDQVDGKTMLFDAPLQMKFHEAS
RQGAEYDMRHIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEPWFKPLAYALILLREN
GVPSVFYPDLYGASYEDSGENGETCRVDMPVINQLDRLILARQRFAHGIQTLFFDHPNCI
AFSRSGTEENPGCVVVLSNGDDGEKTLLLGDNYANKTWRDFLGNRSEHVVTNDQGEATFF
CNAGSVSVWVIEDV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccccacgttattgcagtacttccactggtattatcccgacggcggtaaactc
tggtctgagctggcggaacgtgctgatgggctgaatgatattggtatcaatatggtctgg
ctaccgcccgcctgtaaaggcgcctccggcggctattccgtaggctatgatacctacgac
ctgtttgacctcggcgaatttgaccaaaaaggaactatcgcgacaaagtacggcgataaa
cgccagttactgacggcgatagacgcgctcaaaaaaaataatattgcggtgctgctcgac
gtcgtcgtgaaccacaaaatgggcgcagacgaaaaagaacgtattcgcgttcagcgcgtg
aatcaggatgaccgcacgcaaatcgatgacaacatcattgaatgcgaaggctggacgcgc
tacaccttccctgcccgcgcgggccagtattccaactttatttgggactatcactgtttc
agcggcattgatcacatcgagaatcccgacgaagacggcatttttaagatcgtcaatgac
tataccggcgatggctggaacgatcaggttgatgatgagctgggtaatttcgactatctg
atgggtgaaaatatcgattttcgcaatcacgcggttacggaagagattaaatattgggct
cgttgggtcatggaacaaacccactgtgacggctttcgcctggacgcggtaaaacatata
cccgcctggttttataaagaatggattgagcatgtacaggcggttgcaccaaaaccgctg
tttattgtcgcagaatactggtcgcatgaagtggataaactgaaaacgtacatcgatcag
gtcgacgggaaaaccatgctgttcgacgcgccgttgcagatgaaatttcacgaggcctcg
cgccagggcgcggagtatgacatgcgccacatattcaccggcactctggtagaagccgac
ccttttcatgcggtgacgctggtcgctaaccacgatacacaaccgttacaggcgctggaa
gcgccggtagaaccctggttcaaaccattggcctatgcgctgatcctgcttcgtgaaaac
ggcgtaccgtcagtgttttatcccgatttatacggcgccagctatgaggatagcggcgaa
aatggcgagacctgtcgggtcgacatgccggtgattaaccaactggatcggctgatcctt
gctcgtcagcgttttgcgcacggtatacaaacactctttttcgatcatcctaactgtatc
gcctttagtcgcagcggtactgaagagaatccaggctgtgtggtcgtactttccaatggc
gacgacggtgaaaaaaccctcctgctcggcgacaattacgctaacaagacctggcgtgat
tttctgggaaaccgcagtgagcatgttgtaactaatgatcaaggcgaagcgacgttcttc
tgcaacgcaggcagcgtcagcgtgtgggtcattgaggacgtgtga

DBGET integrated database retrieval system