KEGG   Salmonella enterica subsp. enterica Serovar Cubana: CFSAN002050_25045Help
Entry
CFSAN002050_25045 CDS       T02734                                 

Definition
(GenBank) endonuclease III (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
seec  Salmonella enterica subsp. enterica Serovar Cubana
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4852959..4854068)
Genome map
AA seq 369 aa AA seqDB search
MMTMLRGWITMIVMLTAINAQAACSWPAWEQFKKDYISQQGRVIDPGDARKITTSEGQSY
AMFFALAANDRPAFAQLFNWTQNNLAQGSLREHLPAWLWGQKDPDTWSVLDSNSASDGDI
WMAWSLLEAGRLWKETRYTEVGTALLKRIAREEVVNVPGLGSMLLPGKIGFAKANSWRFN
PSYLPPQLAQYFSRFGAPWSTLRETNLRLLLETAPKGFSPDWVRYESKQGWQLKAEKTLI
SSYDAIRVYLWAGMMHDGDPQKARLLARFKPMATLTMKNGVPPEKVDVVSGNAQGTGPVG
FSAALLPFLQNRDAQAVQRQRVADHFPGSDAYYNYVLTLFGQGWDQHRFRFTVKGELLPD
WGQECVSSR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgatgactatgctgcgcggatggataacgatgatcgtcatgctgacggcaataaatgcg
caggcggcctgtagctggcctgcgtgggaacagttcaagaaagattacattagccagcag
ggacgcgttatcgatccgggcgatgcgcgaaaaattaccacctccgaagggcaaagctac
gccatgttctttgccctggcggcgaacgatcgaccggcgttcgcgcaactgtttaactgg
acgcaaaacaatctggcgcagggatcgctgcgtgaacatctgcccgcctggctgtggggg
caaaaagatcccgacacctggtcggtgctggacagcaactccgcgtccgacggcgatatc
tggatggcatggtcgctgctggaggccggtcgtctgtggaaagagacgcgttataccgag
gtgggcacggcgttgctaaaacgcatcgctcgcgaagaggtcgtgaatgtgccggggctg
ggctcaatgctgctacctggcaaaatcggctttgccaaggcgaatagctggcgttttaac
ccaagctatctgccgccgcagttggcgcaatactttagccgttttggcgcgccgtggtcg
acgctacgggaaaccaatttgcggcttttgctggaaaccgcgccgaaaggtttctcgccg
gactgggtgcgttatgaaagcaagcaaggctggcagttgaaagcggaaaagactctgatc
agtagctacgatgcgattcgcgtctatttatgggcgggaatgatgcatgatggcgatccg
caaaaagcgcgtttactggcgcgatttaaaccgatggcgacgttaacgatgaaaaacggc
gttccaccggagaaagtggatgtcgtcagcgggaacgcgcaagggacggggccggtcggg
ttttccgccgccttactgcctttcctgcaaaatcgcgacgcccaggccgtgcagcgacag
cgggtcgcagaccattttcctggcagcgatgcctattacaactatgtgctgactctcttt
ggccaaggctgggatcagcaccgttttcgcttcaccgtcaaaggtgaattattacctgac
tggggccaggaatgcgtaagttcacgttaa

DBGET integrated database retrieval system