KEGG   Salmonella enterica subsp. enterica serovar Heidelberg 41578: SEEH1578_04390Help
Entry
SEEH1578_04390    CDS       T02736                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
seeh  Salmonella enterica subsp. enterica serovar Heidelberg 41578
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seeh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SEEH1578_04390
   00051 Fructose and mannose metabolism
    SEEH1578_04390
Enzymes [BR:seeh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     SEEH1578_04390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(783160..784482)
Genome map
AA seq 440 aa AA seqDB search
MQAYFDQLDRVRYEGPQSTNPLAFRHYNPDELVLGKRMEDHLRFAACYWHTFCWNGADMF
GVGAFNRPWQQPGEALELAKRKADVAFEFFHKLNVPFYCFHDVDVSPEGASLKEYKNNFA
QMVDVLAAKQEQSGVKLLWGTANCFTNPRYGAGAATNPDPEVFSWAATQVVTAMNATHKL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHKMGFQGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHSFHHEIATAIALGIFGSVDANRG
DAQLGWDTDQFPISVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALSLKIAARMVEDGELDKRVAKRYAGWNGELGQQILKGQLSLGELAQYAEQHNLAPV
HQSGHQELLENLVNRYLFDK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcttattttgaccaactcgatcgtgttcgctatgaaggccctcaatcgactaac
ccgctggcatttcgtcattacaatcccgacgagctggttttaggtaaacgtatggaagat
cacctgcgtttcgcggcctgttactggcataccttctgctggaacggcgcggatatgttt
ggtgtaggcgcgtttaatcgtccgtggcagcaaccgggcgaagcgctggagctggcgaaa
cgcaaagcggacgtggcgtttgaatttttccacaaactgaatgtgcctttttattgcttc
catgacgtggatgtgtcgccggaaggcgcgtcgttgaaagaatataaaaacaacttcgcg
cagatggtggatgtgctggcggcgaaacaggagcagagcggcgtaaaactgctgtgggga
acggcgaactgctttaccaacccgcgctatggcgcaggcgccgccactaacccggatccg
gaagtctttagctgggcagcgacgcaagtggttacggcaatgaacgccacgcataaactg
ggcggcgaaaattacgtcctgtggggcgggcgcgaaggttatgaaacgttgctgaatacc
gatctgcgccaggaacgcgaacagattggccgctttatgcaaatggtggtcgagcacaaa
cataaaatgggtttccagggcacgctgctgattgaaccgaaaccgcaggaaccgactaaa
catcagtatgattatgacgttgcaacggtttatggcttcctcaaacagttcggcctggaa
aaagagatcaaagtgaacattgaggcgaaccacgcgacgctggcgggccattcgttccac
catgaaatcgcaaccgctatcgcgctgggtatttttggctccgttgacgccaaccgcggc
gatgcgcaactgggctgggataccgatcagttcccgattagcgttgaagagaacgcgctg
gtgatgtacgaaatcctgaaagcgggcggattcacgacgggcggtctcaacttcgacgcc
aaagttcgtcgccagagcaccgataaatacgatctgttctacggtcatatcggcgcgatg
gatacgatggcgttgtcgctgaaaatcgccgcgcgtatggttgaagacggcgagctggat
aaacgcgtggcgaagcgctatgccggctggaatggcgagctgggtcagcagattctgaaa
ggacaactctccttaggcgaactggcgcagtatgcggagcagcataatctggcgccagta
catcaaagcggtcatcaggagctgttagaaaatctggttaaccgttatctgtttgataaa
taa

DBGET integrated database retrieval system