KEGG   Salmonella enterica subsp. enterica serovar Heidelberg 41578: SEEH1578_15725Help
Entry
SEEH1578_15725    CDS       T02736                                 

Definition
glutamate dehydrogenase (EC:1.4.1.4)
Orthology
K00262  
glutamate dehydrogenase (NADP+) [EC:1.4.1.4]
Organism
seeh  Salmonella enterica subsp. enterica serovar Heidelberg 41578
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seeh00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    SEEH1578_15725
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SEEH1578_15725
   00330 Arginine and proline metabolism
    SEEH1578_15725
Enzymes [BR:seeh01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.4  glutamate dehydrogenase (NADP+)
     SEEH1578_15725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3172991..3174334)
Genome map
AA seq 447 aa AA seqDB search
MDQTCSLESFLNHVQKRDPHQTEFAQAVREVMTTLWPFLEQNPRYRHMSLLERLVEPERV
IQFRVVWLDDKNQVQVNRAWRVQFNSAIGPYKGGMRFHPSVNLSILKFLGFEQTFKNALT
TLPMGGGKGGSDFDPKGKSEGEVMRFCQALMTELYRHLGPDTDVPAGDIGVGGREVGFMA
GMMRKLSNNSACVFTGKGLSFGGSLIRPEATGYGLVYFTEAMLKRHGLGFEGMRVAVSGS
GNVAQYAIEKAMAFGARVVTASDSSGTVVDESGFTPEKLARLCEIKASRDGRVADYAREF
GLTYLEGQQPWSVPVDIALPCATQNELDVDAARVLIANGVKAVAEGANMPTTIEATDLFL
EAGVLFAPGKAANAGGVATSGLEMAQNAARLSWKAEKVDARLHHIMLDIHHACVEYGGDN
KHTNYVQGANIAGFVKVADAMLAQGVI
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggatcagacatgttctctggaatcgttcctcaaccatgtacaaaagcgcgacccgcat
caaaccgagttcgcgcaagccgtccgtgaagtcatgaccaccctgtggccgtttcttgaa
caaaacccccgttaccgccacatgtctttactggaacgtttggttgaaccagagcgcgta
atccagtttcgcgtagtgtggctggacgacaaaaaccaggtgcaggtaaatcgcgcctgg
cgcgtgcagttcaactctgctatcggcccctataaaggcggtatgcgcttccatccttcg
gtaaacctttccatccttaagttcctcggctttgagcaaacctttaaaaatgccctcacc
acgttgccgatgggcggcggtaaaggcggcagcgatttcgatccgaaagggaaaagcgaa
ggcgaagtgatgcgtttctgccaggcgctgatgactgaactgtatcgccatttagggccg
gataccgacgtgcctgccggggatatcggcgtgggcgggcgcgaagtgggctttatggcg
ggaatgatgcgcaagctttccaataacagcgcctgcgtcttcaccggcaaagggctttcc
ttcggcggcagcctgattcgcccggaggcgacgggctatggcctggtctactttaccgaa
gcgatgcttaaacgtcatggtctcggtttcgaagggatgcgcgtcgccgtgtccggctcc
ggcaacgtagcgcaatacgccattgagaaagcgatggcctttggcgcgcgcgtggttacc
gcgtcggattcgagcggaacggtggtcgatgaaagtggcttcacgccagagaagctggcg
cgtctgtgtgaaattaaagccagccgtgacggtcgcgtcgctgactacgcccgtgagttt
ggcttaacctatctggaaggccagcagccctggagcgtaccggtggatatcgccctgcca
tgcgcgacgcagaacgaactggacgttgacgccgcgcgcgtactgattgccaatggcgta
aaagccgtggcggaaggggcaaatatgccaaccacgattgaagcgaccgatctcttcctt
gaagcgggcgtactgtttgcgccgggtaaagccgccaacgcgggcggcgtggcgacatcg
gggctggaaatggcgcagaacgccgcgcggttgagctggaaagccgagaaagtggacgcc
cgtctgcatcacattatgctggatatccaccacgcctgtgtcgagtacggcggcgataat
aagcataccaactacgttcagggcgccaacatcgccggtttcgtgaaagtcgccgacgcc
atgctggcgcagggcgtcatttaa

DBGET integrated database retrieval system