KEGG   Salmonella enterica subsp. enterica serovar Heidelberg 41578: SEEH1578_18235Help
Entry
SEEH1578_18235    CDS       T02736                                 

Definition
(GenBank) glutamate dehydrogenase
  KO
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
seeh  Salmonella enterica subsp. enterica serovar Heidelberg 41578
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:seeh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SEEH1578_18235
  Energy metabolism
   00910 Nitrogen metabolism
    SEEH1578_18235
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SEEH1578_18235
   00220 Arginine biosynthesis
    SEEH1578_18235
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SEEH1578_18235
Enzymes [BR:seeh01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     SEEH1578_18235
Exosome [BR:seeh04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SEEH1578_18235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3690034..3691308
Genome map
AA seq 424 aa AA seqDB search
MDKLSYASDSSTSAWNTYLQQIERVAPYLGELSPWVDTLRHPKRALIVDIPVQMDDGTIR
HFEGYRVQHNLSRGPGKGGVRYHPDVDLNEVMALSAWMTIKCAALNLPYGGAKGGIRVDP
FSLSEGELERLTRRYTSEIGIIIGPQKDIPAPDVGTNGKVMAWMMDTYSMNHGTTVTGVV
TGKPIHLGGSLGREKATGRGVFVSGLEAARRANIAVEGARVAVQGFGNVGSEAARLFAGA
GARVVAIQDHTATLFNATGIDMKALTAWQTEHKQIAGFPGAETIASDAFWRLEMDILIPA
ALEGQITRQRAEALTCKLVLEGANGPTYPDADDVLASRGILVVPDVVCNAGGVTVSYFEW
VQDMASFFWSEEEINARMDKIMTDAIVHVWEKAAEKSCSLRTAAYIVACERILLARKDRG
IYPG
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggataagttatcttacgcttcagatagcagcacatctgcctggaatacctacctgcaa
caaatcgagcgtgtggccccttatctgggcgagttatccccctgggtggatactctgcgc
cacccaaaacgcgctctgatcgtcgatattccggtacaaatggatgatggcactattcgt
catttcgaaggatatcgcgtgcagcacaacctctcccgaggtccgggtaaaggcggtgtt
cgctaccatcctgacgttgatctcaatgaagtgatggccctgtcagcatggatgaccatc
aaatgtgccgcgctgaacctgccatacggcggcgctaaaggcggtatccgcgtcgatccg
ttctcgctgtcggaaggtgaactggagcgtttgacccgccgctataccagcgagatcggc
attatcatcgggccgcagaaagatattcctgcgccggatgtcggcaccaacggtaaagtg
atggcctggatgatggatacgtattccatgaatcatggcacgacggtcactggcgtcgtc
accggtaagcctatccatcttggcggttcgctgggccgtgaaaaagcgacggggcgcggc
gttttcgtcagcgggctggaagccgcacgtcgggcgaatattgctgttgaaggcgctcgc
gttgcggttcagggttttggtaacgtcggcagcgaagccgcgcgtctgtttgcaggcgct
ggcgcccgtgtcgtggcgattcaggatcataccgcgaccctgtttaacgccaccggtatt
gacatgaaggcgctcacggcatggcagacagaacacaaacagatagccggtttcccgggc
gcggaaactatcgccagcgatgcgttctggcgtctggagatggatattctgatcccggcg
gcgcttgaaggtcagataactcgtcagcgcgcggaagccctgacgtgtaagctggtgctg
gaaggggctaacggcccaacctatccggatgctgatgatgttctggccagccgtggtatc
cttgtggtgcctgacgtggtctgtaacgcaggcggcgtaaccgtcagctacttcgaatgg
gtacaagatatggccagcttcttctggagcgaagaagagatcaatgcgcgcatggacaaa
atcatgaccgacgcgattgtccatgtctgggagaaagcggctgagaaatcctgctctctg
cgcaccgcagcctatattgtcgcctgtgagcgcattctgctggcccgtaaagatcgcggt
atctatccaggttaa

DBGET integrated database retrieval system