KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 08-1736: SE451236_03220Help
Entry
SE451236_03220    CDS       T02738                                 

Definition
glycogen-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
seen  Salmonella enterica subsp. enterica serovar Typhimurium 08-1736
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:seen00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SE451236_03220
Enzymes [BR:seen01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SE451236_03220
Exosome [BR:seen04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SE451236_03220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
690327..692513
Genome map
AA seq 728 aa AA seqDB search
MSSRIDRDVINALIAGHFADPFSVLGMHQTQAGLEVRALLPDATDVWVIEPKTGRKVGKL
ECLDARGFFCGVLPRRKNFFRYQLAVTWHGQQNLIDDPYRFGPLIQEMDAWLLSEGTHLR
PYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDGRRHPMRLRKESGIWELFIP
GAHNGQLYKFELLDANGNLRIKADPYAFEAQMRPETASMICGLPEKVTPGEERQKANQFD
APISIYEVHLGSWRRHTDNNFWLSYRELADQLVPYAKWMGFTHLELLPVNEHPFDGSWGY
QPTGLYAPTRRFGTRDDFRYFINAAHAAGLNVILDWVPGHFPSDEFSLAEFDGTHLYEHS
DPREGYHQDWNTLIYNYGRREVSNYLVGNALYWMERFGIDALRVDAVASMIYRDYSRKEG
EWIPNEFGGRENLEAIEFLRNTNRIIGEQVPGAVSMAEESTDFSGVTRPPETGGLGFWYK
WNLGWMHDTLDYMKLDPVYRQYHHDKLTFGMLYNHTENFVLPLSHDEVVHGKKSILDRMP
GDAWQKFANLRAYYGWMWAFPGKKLLFMGNEFAQGREWNHDASLDWHLLEGGDNWHHGVQ
RLVRDLNHTYRHHKALHELDFDAYGFEWLVVDDNERSVLIFVRRDKAGNEIIVASNFTPV
PRHDYRFGINQPGRWREILNTDSMHYHGSNTGNGGVVHSDEIESHGRQHSLNLTLPPLAT
IWLMREGE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtcgtatcgatagagacgtgattaatgcgctaattgcaggacattttgcggac
cctttttccgtactcggaatgcaccagacccaagccggactagaagtccgcgccctctta
cctgacgccaccgacgtatgggtgattgagcccaaaaccggacgtaaagtcggcaaactg
gaatgtctcgacgctcgcggttttttctgcggcgttttaccccgacgtaaaaatttcttt
cgctatcagctcgccgtgacctggcacggacagcagaacctcatcgacgatccttaccgt
tttggtccattaatacaggaaatggatgcctggctattgtcggaaggcacccacctgcgt
ccttatgaaacgctgggcgcgcacgccgatacgatggatggcgtcaccggcacccgtttc
tccgtctgggcgcctaatgctcgtcgcgtttcggttgtcgggcaattcaactattgggat
gggcgtcgccacccgatgcgtctgcgcaaagagagcggtatttgggagctgtttatcccc
ggcgcgcataatggacaactgtataaattcgagctgcttgatgcgaacggtaatctgcgc
attaaagccgatccctatgcttttgaggcgcagatgcgtccggaaacggcgtcgatgatt
tgcggactgccggagaaagtgacgccaggcgaagaacgacaaaaagccaatcagtttgat
gcgccgatctcgatttatgaggtgcatttaggttcatggcgccgccatacggataacaat
ttctggctgagctatcgtgagctggcggatcagcttgtgccttacgccaaatggatgggc
tttactcaccttgaactcttgccggtcaacgaacatccgtttgacggcagttggggctac
cagccgaccggcctctacgcgccgacccgccgctttggtacgcgagacgacttccgttat
ttcatcaatgcggcccatgcggcgggccttaacgtcattctcgactgggtgccgggccat
ttcccgtccgatgaatttagcctcgcggagtttgacggcacccacctctatgagcacagc
gacccgcgcgagggctatcaccaggactggaatacgctgatctacaactatggtcgtcgt
gaagtcagtaattatctggtgggtaacgccctgtactggatggagcgttttgggattgat
gcgctgcgtgtcgatgcggtggcctctatgatctaccgcgactacagccgcaaagagggc
gagtggataccgaacgagttcggcggtcgtgaaaacctggaagccattgagtttctgcgt
aataccaaccgcattattggcgagcaggtgcccggcgcggtcagcatggcggaagagtcg
acagacttctctggcgtgacgcgtccaccggaaacgggtgggctggggttctggtacaag
tggaatctgggctggatgcacgacacgctggactacatgaagctggacccggtgtaccgc
cagtatcatcacgacaagctgacctttggtatgttgtacaaccataccgaaaactttgtt
ctgccgctgtcgcacgatgaggtggttcacggcaagaaatccattctcgatcgtatgccg
ggcgatgcgtggcaaaaattcgccaacctgcgcgcctattatggttggatgtgggccttc
cccggcaagaaactgctgtttatggggaatgagtttgcccagggacgcgagtggaaccat
gacgccagcctcgactggcacctgctggaggggggcgataactggcaccacggggttcag
cgtctggtgcgcgatctcaaccacacctatcgccaccataaagcgttgcatgagctggat
tttgatgcttacggctttgagtggctggtggtcgatgacaatgaacgctcggtactgatt
tttgtacgccgtgataaagccggtaacgagatcatcgtcgccagcaactttacgcccgtt
cctcgccacgactaccgctttggcatcaaccagccgggacgctggcgtgaaattctcaat
actgattcgatgcattatcacggtagcaacaccggcaatggcggcgtggtgcacagcgat
gagatcgaaagccatggccgtcagcactctcttaacctgacgttaccgccgttggcgacg
atctggctgatgcgggagggggaatga

DBGET integrated database retrieval system