KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 08-1736: SE451236_05165Help
Entry
SE451236_05165    CDS       T02738                                 

Definition
lysosomal glucosyl ceramidase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
seen  Salmonella enterica subsp. enterica serovar Typhimurium 08-1736
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seen00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SE451236_05165
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SE451236_05165
Enzymes [BR:seen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     SE451236_05165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
1100027..1101370
Genome map
AA seq 447 aa AA seqDB search
MKGRLISSDPYRQQFLVERAVSFSHRQRDCSELISVLPRHALQQIDGFGGSFTEGAGVVF
NSMSEKTKAQFLSLYFSAQEHNYTLARMPIQSCDFSLGNYAYVDSSADLQQGRLSFSRDE
AHLIPLISGALRLNPHMKLMASPWSPPAFMKTNNDMNGGGKLRRECYADWADIIINYLLE
YRRHGINVQALSVQNEPVAVKTWDSCLYSVEEETAFAVQYLRPRLARQGMDEMEIYIWDH
DKDGLVDWAELAFADEANYKGINGLAFHWYTGDHFSQIQYLAQCLPDKKLLFSEGCVPME
SDAGSQIRHWHTYLHDMIGNFKSGCSGFIDWNLLLNSEGGPNHQGNLCEAPIQYDAQNDV
LRRNHSWYGIGHFCRYVRPGARVMLSSSYDNLLEEVGFVNPDGERVLVVYNRDVQERRCR
VLDGDKEIALTLPPSGASTLLWRQESI
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcagactcatctcttccgatccgtatcgtcagcaattccttgttgagcgtgcg
gtctctttttcgcatcgtcagcgtgattgcagtgaattaatcagcgtcttaccgcgccac
gcgttacagcagattgacggattcggcggcagctttaccgaaggtgcgggcgtggtattc
aacagcatgagcgaaaagacgaaggcgcaatttctttccctttatttttctgctcaggaa
cataattacactctggcgcggatgccaattcagagctgtgatttttccctgggcaattac
gcgtatgtcgattccagcgctgacctgcagcagggacggctctccttttcccgcgatgaa
gcgcatttaataccgctgatttccggggcgttgcggttaaatccacacatgaagctgatg
gcttcgccgtggagtccgccggcgtttatgaaaactaataacgatatgaacggtggcggc
aagctgcggcgcgaatgctacgccgactgggccgatatcattatcaactacctgctggaa
taccgccgccacggcattaatgtgcaggcgctctccgtgcagaatgagccggtggcggta
aaaacctgggactcctgtctgtatagcgtggaagaggagacagcctttgccgtgcagtat
ctgcgtccgcgcctcgcccggcagggtatggatgagatggagatctatatctgggatcac
gataaagatggcctggtggactgggctgaactcgcctttgctgacgaagctaattataag
ggaattaacgggctggcattccactggtataccggcgaccatttttcgcaaatacagtat
ctggcccagtgcctgccggataaaaaactcctgttttccgaaggctgtgtgccaatggag
agcgatgccggtagccagattcgccactggcatacctatctccatgacatgattggtaat
ttcaaatcgggttgtagcgggtttatcgactggaatctgctgctgaacagtgagggcggg
ccgaatcatcagggtaatctgtgtgaagcgcccattcaatacgatgcgcaaaacgacgtg
ctgcggcgtaaccactcctggtatggtattggccacttctgccgctatgtgcgtccgggg
gcgagggtcatgctttcttcaagttacgataatcttctggaagaggtgggatttgtgaat
cccgacggcgagcgtgtgctggtggtgtataaccgcgatgtccaggaaaggcgttgccgg
gtgctggatggcgataaagagatcgcgttaacgctgccgccgtcaggcgccagtacgttg
ctatggcggcaggagtcgatctga

DBGET integrated database retrieval system