KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 08-1736: SE451236_06970Help
Entry
SE451236_06970    CDS       T02738                                 

Gene name
mrcB
Definition
bifunctional glycosyl transferase/transpeptidase
Orthology
K05365  
penicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]
Organism
seen  Salmonella enterica subsp. enterica serovar Typhimurium 08-1736
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:seen00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SE451236_06970 (mrcB)
Enzymes [BR:seen01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     SE451236_06970 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     SE451236_06970 (mrcB)
Glycosyltransferases [BR:seen01003]
 Polysaccharide
  Bacterial polysaccharide
   SE451236_06970 (mrcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1509363..1511885
Genome map
AA seq 840 aa AA seqDB search
MAGNDREPIGRKGKPSRPVKQKVSRRRQHDDDYDDDYEDEEPMPRKGKGKGRKPRGKRGW
LWLLLKLFIVFVVLFAIYGVYLDQKIRSRIDGKVWQLPAAVYGRMVNLEPDMPVSKNEMV
KLLEATQYRLVTKMTRPGEFTVQANSIEMIRRPFDFPDSKEGQVRARLTFSDGRLETIVN
LDNNRQFGFFRLDPRLITMLSSPNGEQRLFVPRSGFPDLLVDTLLATEDRHFYEHDGISL
YSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWRKANEAYMALIMDARYSKDR
ILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLDQQALLVGMVKGASIYNPWRN
PKLALERRNLVLRLLQQQKIIDQELYDMLSARPLGVQPRGGVISPQPAFMQMVRQELQAK
LGDKIKDLSGVKIFTTFDSVAQDAAEKAVVEGIPALKKQRKLSDLETAMVVVDRFSGEVR
AMVGGAEPQYAGYNRAMQARRSIGSLAKPATYLTALSQPNLYRLNTWIADAPISLRQPNG
QVWSPQNDDRRYSESGKVMLVDALTRSMNVPTVNLGMALGLPAVTDTWTKLGVPKDQLNP
VPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGKVLYQSYPQAERAVPAQ
AAYLTLWTMQQVVQRGTGRQLGAKYPGLHLAGKTGTTNNNVDTWFAGIDGSQVTITWVGR
DNNQPTKLYGASGAMAIYQRYLANQTPTPLVLTPPEDVVDMGVDYDGNFVCSGGMRTLPV
WTDDPNTLCQQGEMMQQQQQPSGNPFDQSSQPQQPAQQQPPKEEKSDGVAGWIKEMFGGN
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaatgaccgcgagccgattggacgtaaggggaaaccgtcacgtcctgtgaaa
caaaaggtgagccgtcgtcggcagcatgacgacgattatgatgatgactatgaggatgaa
gaaccgatgccgcgtaaaggtaagggcaaagggcgtaagcctcgtggcaagcgcggctgg
ctgtggctattgctaaaactgtttatcgtttttgtggtgctgttcgccatttacggcgtc
tatctggatcaaaaaatccgcagccgtatcgatggcaaggtctggcagcttccggcggcg
gtatatggccggatggtgaaccttgagccagacatgcctgtcagcaaaaacgagatggtg
aaattgctggaagcgacgcagtatcgtctggtgacgaagatgacccgtcccggcgaattt
accgtgcaggccaatagcattgagatgatccgtcgtccgtttgacttcccggacagcaaa
gaagggcaggtgcgcgcgcggctgacgttcagtgacgggcgtctggaaaccatcgtcaat
ctggataacaaccgccagtttggcttcttccgtctcgatccgcggcttatcaccatgctt
tcttcgccaaatggcgagcagcgtttattcgtcccgcgcagcggtttcccggatctgctg
gtcgatacgctgttggcgacggaagaccgtcatttctatgagcatgatggcattagtctt
tactctatcgggcgtgcggtgctggccaacctgacggcgggacgcacggtgcagggggcc
agtacgctgacccagcagctggtgaagaacctgttcctctccagcgaaagatcatactgg
cgtaaagcgaatgaagcctacatggcgctgatcatggatgcccgttacagtaaagatcgt
attcttgagctgtacatgaacgaggtctacctcggtcaaagcggggacaatgaaattcgc
ggttttccgctggcgagcctgtattactttggtcgtccggtagaggaactgagcctcgat
cagcaggcgttactggtggggatggtaaaaggggcgtcgatttataacccgtggcgtaac
ccgaaactggcgttggagcgtcgtaacctggtgttacgcctgttacagcagcagaaaatc
atcgatcaggaactctatgacatgctgagcgcgcgtccgcttggcgtacagccgcgcggc
ggcgttatttcaccgcagccagcgtttatgcagatggttcgtcaggaactgcaggcgaag
ctgggggataaaattaaagatctctccggcgtgaagatcttcaccacctttgactccgtg
gcgcaggatgccgcagaaaaagccgttgtcgaaggtattccggcgttgaagaagcagcgt
aaattgagcgatctggaaaccgcgatggtggtggtggatcgctttagcggcgaggtgcgc
gcgatggttggcggggcggagccgcagtatgccggctataaccgtgccatgcaggcgcgc
cgttccatcgggtcgctggcgaaaccggcgacctatctgaccgcgttaagtcagccgaac
ttataccgtctgaacacctggattgccgatgcgccgatttctctgcgccagccgaatggt
caggtctggtcgccgcagaacgacgatcgtcgctacagcgaaagcgggaaagtgatgctg
gtggatgcgttaactcgctcaatgaacgtaccgacggtcaatctggggatggcgttaggt
ttaccggcggtaaccgatacctggacgaagctcggcgtgccgaaagatcagctcaatccg
gttccggctatgctgttaggagcgctgaacctgacgccgatcgaagtggcgcaggcgttc
cagactatcgccagcggcggaaatcgcgcgccgttatcagcgctgcgttcagttattgcg
gaagatggtaaagtgctgtaccaaagttatccgcaagctgaacgcgccgtaccggcacag
gcggcttacctgacgctctggacaatgcagcaggtcgtccagcgtggtacggggcgtcag
cttggcgcgaaatatccgggtctgcatctggccggtaaaaccgggacgacaaacaacaat
gtcgatacctggtttgccggtatcgacggcagccaggtgactatcacctgggtaggccgt
gataacaaccagccgacgaaattgtacggcgccagcggcgcgatggcgatttaccagcgc
tatctggcgaaccagacgccgacgcctttagttctgacgccgccggaagatgtggtggat
atgggcgttgattacgacggtaattttgtctgtagcggcggtatgcgcactctgccggtc
tggacggacgatccaaatacgctgtgccagcagggcgagatgatgcagcaacagcagcag
ccgtcaggcaatccgttcgatcagtcgtctcagccgcagcagcctgcgcagcaacagccg
ccgaaagaagagaagagcgacggcgttgccggctggattaaggagatgttcggcggcaat
taa

DBGET integrated database retrieval system