KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 08-1736: SE451236_14690Help
Entry
SE451236_14690    CDS       T02738                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
seen  Salmonella enterica subsp. enterica serovar Typhimurium 08-1736
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:seen00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3093331..3093948)
Genome map
AA seq 205 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPAK
LFNQNTSLFEEIRAESARQTIHCVLVDESQFLTRQQVYQLSEVVDKLDIPVLCYGLRTDF
RGELFVGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQDGRPYNEGEQVVIGGNERYVS
VCRKHYKDALEEGSLTAIQERHRHI
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcacagctatatttctactattcggcaatgaatgcgggtaagtcgactgcactgctg
caatcttcatacaattatcaggaacgcgggatgcgtaccgtcgtatatacggcggaaatc
gacgatcgtttcggcgcaggcaaagtcagctctcgtatcggtttgtcgtcgccggcaaaa
ttgtttaaccaaaatacatccttgtttgaagagattcgtgccgagagcgcgcggcagaca
atacattgcgtgttagtcgacgaaagccagtttttgactcgccagcaggtttatcaatta
tccgaggttgtcgacaaattagatattccagtactttgctatgggctacgaacagacttt
cgtggggagctctttgtcggcagccaatacttgctggcatggtcagataagctggtggaa
ttaaaaactatctgtttctgcggtcgtaaagccagtatggttctgcgccttgatcaggac
ggcaggccttataacgaaggcgaacaggtggttattggcgggaatgaacgctacgtttca
gtttgccgtaagcattataaggacgcgctggaggagggctcactgacggcgattcaggag
cgtcatcggcacatatga

DBGET integrated database retrieval system