KEGG   Salmonella enterica subsp. enterica serovar 4,[5],12 i - str. 08-1736: SE451236_20965Help
Entry
SE451236_20965    CDS       T02738                                 

Definition
(GenBank) fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
seen  Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
Pathway
seen00051  Fructose and mannose metabolism
seen01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:seen00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SE451236_20965
Enzymes [BR:seen01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SE451236_20965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-GeneID: 16389679
NCBI-ProteinID: AGQ87265
Position
complement(4381021..4381668)
Genome map
AA seq 215 aa AA seqDB search
MERNRLARQIIDTCLEMTRLGLNQGTAGNVSVRYQGGLLITPTGIPYEKLTESHIVFIDA
DGQHEQGKLPSSEWRFHMAAYQTRPDANAVVHNHAVHCTAVSILNRPIPAIHYMIAAAGG
NSIPCAPYATFGTRELSDHVAVALKNRKATLLQHHGLIACEENLDKVLWLAHEVEVLAQL
YLSTLAIVDPVPVLDDEAIAIVLEKFKTYGLRIEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaacgaaatagactggcgcggcagattattgatacctgtctggaaatgacgcggtta
gggttaaatcaggggacggcaggtaacgtgagcgtacgttatcagggcggattgctgatt
acgccgacggggatcccctacgagaagctgacagagtcgcacattgtctttattgatgct
gacggtcagcatgagcagggcaagctgccttccagcgagtggcgttttcatatggcggca
taccagacgcgccctgacgccaatgccgtggtacataaccacgctgtccattgtacggca
gtctcgatcctgaatcgcccgattccggcgattcactacatgattgccgccgcaggagga
aactctattccctgcgcgccctacgccacttttggcacccgcgaactttctgaccatgtt
gccgtggcgcttaaaaatcgtaaagcgacgctgttacagcatcacgggcttatcgcttgt
gaagaaaatttagacaaagtgttgtggctggcgcatgaagtggaagtgctggcgcagctc
tatttaagtacgctggccattgtcgatccggtaccggtactggatgacgaggcgatcgct
atcgtactggagaaatttaaaacttacggattacgtattgaagagtga

DBGET integrated database retrieval system