KEGG   Salmonella enterica subsp. enterica serovar Pullorum: I137_07280Help
Entry
I137_07280        CDS       T02790                                 

Definition
glutamate dehydrogenase
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
seep  Salmonella enterica subsp. enterica serovar Pullorum
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seep00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    I137_07280
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    I137_07280
   00330 Arginine and proline metabolism
    I137_07280
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    I137_07280
Enzymes [BR:seep01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     I137_07280
Exosome [BR:seep04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   I137_07280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1603474..1604799
Genome map
AA seq 441 aa AA seqDB search
MYHGQLKNILLLSLRFIMDKLSYASDSSTSAWNTYLQQIERVAPYLGELSPWVDTLRHPK
RALIVDIPVQMDDGTIRHFEGYRVQHNLSRGPGKGGVRYHPDVDLNEVMALSAWMTIKCA
ALNLPYGGAKGGIRVDPFSLSEGELERLTRRYTSEIGIIIGPQKDIPAPDVGTNGKVMAW
MMDTYSMNHGTTVTGVVTGKPIHLGGSLGREKATGRGVFVSGLEAARRANIAVEGARVAV
QGFGNVGSEAARLFAGAGARVVAIQDHTATLFNATGIDMKALTAWQTEHKQIAGFPGAET
IASDAFWRLEMDILIPAALEGQITRQRAEALTCKLVLEGANGPTYPDADDVLASRGILVV
PDVVCNAGGVTVSYFEWVQDMASFFWSEEEINARMDKIMTDAIVHVWEKAAEKSCSLRTA
AYIVACERILLARKDRGIYPG
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgtaccacggtcaattaaagaacatattacttttatcactaaggtttatcatggataag
ttatcttacgcttcagatagcagcacatctgcctggaatacctacctgcaacaaatcgag
cgtgtggccccttatctgggcgagttatccccctgggtggatactctgcgccacccaaaa
cgcgctctgatcgtcgatattccggtacaaatggatgatggcactattcgtcatttcgaa
ggatatcgcgtgcagcacaacctctcccgaggtccgggtaaaggcggtgttcgctaccat
cctgacgttgatctcaatgaagtgatggccctgtcagcatggatgaccatcaaatgtgcc
gcgctgaacctgccatacggcggcgctaaaggcggtatccgcgtcgatccgttctcgctg
tcggaaggtgaactggagcgtttgacccgccgctataccagcgagatcggcattatcatc
gggccgcagaaagatattcctgcgccggatgtcggcaccaacggtaaagtgatggcctgg
atgatggatacgtattccatgaatcatggcacgacggtcactggcgtcgtcaccggtaag
cctatccatcttggcggttcgctgggccgtgaaaaagcgacggggcgcggcgtttttgtc
agcgggctggaagccgcacgtcgggcgaatattgctgttgaaggcgctcgcgttgcggtt
cagggttttggtaacgtcggcagcgaagccgcgcgtctgtttgcaggcgctggcgcccgt
gtcgtggcgattcaggatcataccgcgaccctgtttaacgccaccggtattgacatgaag
gcgctcacggcatggcagacagaacacaaacagatagccggtttcccgggcgcggaaact
atcgccagcgatgcgttctggcgtctggagatggatattctgatcccggcggcgcttgaa
ggtcagataactcgtcagcgcgcggaagccctgacgtgtaagctggtgctggaaggggct
aacggcccgacctatccggatgctgatgatgttctggccagccgtggtatccttgtggtg
cctgacgtggtctgtaacgcaggcggcgtaaccgtcagctacttcgaatgggtacaagat
atggccagcttcttctggagcgaagaagagatcaacgcgcgcatggacaaaatcatgacc
gacgcgatcgtccatgtctgggagaaagcggctgagaaatcctgttctctgcgcaccgca
gcctatattgtcgcctgtgagcgcattctgttggcccgtaaagatcgcggtatctatccg
ggttaa

DBGET integrated database retrieval system