KEGG   Salmonella enterica subsp. enterica serovar Pullorum: I137_08400Help
Entry
I137_08400        CDS       T02790                                 

Definition
alpha-amylase (EC:3.2.1.1)
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
seep  Salmonella enterica subsp. enterica serovar Pullorum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:seep00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1809293..1810777
Genome map
AA seq 494 aa AA seqDB search
MKNPTLLQYFHWYYPDGGKLWSELAERADGLNDIGINMVWLPPACKGASGGYSVGYDTYD
LFDLGEFDQKGTIATKYGDKRQLLTAIDALKKNNIAVLLDVVVNHKMGADEKERIRVQRV
NQDDRTQIDDNIIECEGWTRYTFPARAGQYSNFIWDYHCFSGIDHIENPDEDGIFKIVND
YTGDGWNDQVDDELGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTHCDGFRLDAVKHI
PAWFYKEWIEHVQAVAPKPLFIVAEYWSHEVDKLQTYIDQVDGKTMLFDAPLQMKFHEAS
RQGAEYDMRHIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEPWFKPLAYALILLREN
GVPSVFYPDLYGASYEDNGENGETCRVDMPVINQLDRLILARQRFAHGIQTLFFDHPNCI
AFSRSGTEENPGCVVVLSNGDDGEKTLLLGDNYANKTWRDFLGNRSQHVVTNDQGEATFF
CNAGSVSVWVIEDV
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccccacgttattgcagtacttccactggtattatcccgacggcggtaaactc
tggtctgagctggcggaacgtgctgatgggctgaatgatatcggtatcaatatggtctgg
ctaccgcccgcctgtaaaggcgcctccggcggctattccgtaggctatgatacctacgac
ttgtttgacctcggcgaatttgaccaaaaaggaactatcgcgacaaagtacggcgataaa
cgccagttactgacggcgatagacgcgctcaaaaaaaataatattgcggtgctgctcgac
gtcgtcgtgaaccacaaaatgggcgcagacgaaaaagaacgtattcgcgttcagcgcgtg
aatcaggatgaccgcacgcaaatcgatgacaacatcattgaatgcgaaggctggacgcgc
tacaccttccctgcccgcgcgggccagtattccaactttatttgggactatcactgtttc
agcggcattgatcacatcgagaatcccgacgaagacggcatttttaagatcgtcaatgac
tataccggcgatggctggaacgatcaggttgatgatgagctgggtaatttcgactatctg
atgggggaaaatatcgattttcgcaatcacgcggttacggaagagattaaatattgggct
cgttgggtcatggaacaaacccactgtgacggctttcgcctggacgcggtaaaacatata
cccgcctggttttataaagaatggattgagcatgtacaggcggttgcgccaaaaccgctg
tttattgtcgcagaatactggtcgcatgaagtggataaactgcaaacgtacatcgatcag
gtcgacgggaaaaccatgctgttcgacgcgccgttgcagatgaaatttcatgaagcctcg
cgccagggcgcggagtatgacatgcgccacattttcaccggcacgctggtagaagccgac
ccttttcatgcggtgacgctggtcgctaaccacgatacacaaccgttacaggcgctggaa
gcgccggtagaaccctggttcaaaccattggcctatgcgctgatcctgcttcgtgaaaac
ggcgtaccgtcggtgttttatcccgatttatacggcgccagctatgaggataatggcgaa
aatggcgagacctgtcgggtcgacatgccggtgattaaccaactggatcggctgatcctc
gctcgtcagcgttttgcgcacggtatacaaacactctttttcgatcatcctaactgtatc
gcctttagtcgcagcggtactgaagagaatccaggctgtgtggttgtactttccaatggc
gacgacggtgaaaaaaccctcctgctcggcgacaattacgctaacaagacctggcgtgat
tttctgggaaaccgcagtcagcatgttgtaactaatgatcaaggcgaagcgacgttcttc
tgcaacgcaggcagcgtcagcgtgtgggtcattgaggacgtgtga

DBGET integrated database retrieval system