KEGG   Salmonella enterica subsp. enterica serovar Pullorum: I137_09950Help
Entry
I137_09950        CDS       T02790                                 

Definition
acyl-CoA thioesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
seep  Salmonella enterica subsp. enterica serovar Pullorum
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:seep00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:seep00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2159060..2160343
Genome map
AA seq 427 aa AA seqDB search
MNTLSVSRLALALAFGVTLSACSSTPPDQIPSDQTAPGTASRPILSANEAKNFVAARYFA
SLTPNTAPWSPSPITLPAQPDFVVGPAGTPGVTHTSIQAAVDAAMVKRTNKRQYIAIMPG
DYQGTVYVPAAPGSLTLYGTGEKPIDVKIGMAIDGEMSVADWRRAVNPGGKYMPGKPAWY
MFDNCQSKHAATIGVMCSAAFWSQNNGLQLQNLTIENTLGDSVDAGNHPAVALRTDGDKV
QINKVNILGRQNTFFVTNSGVQNRLQTDRQPRTLVTNSYIEGDVDMVSGRGAVVFDNTNF
QVVNSRTQQEAYVFAPATLSNIYYGFLAINSRFNASGDGVAQLGRSLDVDANTNGQVVIR
DSVINEGFNVAKPWADAVISKRPFAGNTGTVDDKDEVQRNLNDTNYNRMWEYNNRGVGSK
VVAEPKQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaatacattatcggtttcccgtctggcgctggcactggcttttggcgtgacgctgagc
gcctgtagctctacgccacccgatcagatcccttccgatcaaaccgcgcctggcaccgcc
tcgcgcccaattctgtcggcaaatgaagcgaaaaacttcgttgcggcgcgctattttgcc
tccctgacgccgaataccgccccgtggtcgccgtcgccgattaccctgcccgcacagcct
gactttgtggtggggccggcaggtacgccaggcgttacgcacacctcgattcaggccgcg
gtcgatgcggcaatggttaaacgcacgaacaaacgccagtacattgctattatgccgggc
gactatcaggggaccgtgtatgttcccgccgcgccgggaagtctgaccctgtacgggacc
ggtgaaaaaccgatcgatgtgaaaattgggatggcgattgatggtgaaatgagcgtcgct
gactggcgccgcgcggtgaatcccggcgggaaatatatgcctggtaaacccgcctggtat
atgttcgataactgccaaagcaaacacgccgcgacgatcggtgtgatgtgttctgccgcg
ttctggtcgcagaataacggtctgcagctacaaaatctgaccatcgagaacacgctaggc
gacagcgtcgatgccggaaaccatccggcggtggcgttgcgtaccgatggcgacaaagtc
cagattaacaaggtcaatatccttggccgccagaacaccttctttgtgaccaacagcggc
gtgcagaaccgtctgcaaaccgatcgccagccgcgtacgctggtgacgaacagctatatt
gaaggcgatgtggatatggtttccggacgcggcgccgtggtgttcgataacaccaacttc
caggtcgtcaactcccgcacacagcaggaagcctacgtcttcgccccggcgacgctgtcc
aatatttactatggctttttggcgatcaacagccgctttaacgcctccggcgatggcgtt
gcgcagcttggccgctcgctggatgtcgacgccaacaccaacggtcaggtcgtgatccgc
gacagcgtgattaacgagggcttcaacgttgccaaaccgtgggccgacgcggtcatctcg
aaacgtccgtttgctggaaatacggggaccgtggatgacaaagacgaggtgcagcgtaat
ctgaacgacactaactacaaccgcatgtgggaatacaacaaccgcggtgtaggcagtaaa
gtagtggcggaacctaagcagtaa

DBGET integrated database retrieval system