KEGG   Salmonella enterica subsp. enterica serovar Pullorum: I137_13025Help
Entry
I137_13025        CDS       T02790                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
seep  Salmonella enterica subsp. enterica serovar Pullorum
Brite
Enzymes [BR:seep01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     I137_13025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2793466..2793981)
Genome map
AA seq 171 aa AA seqDB search
MNPSIVKRCLVGAVLAIAATLPGFQQLHTSVEGLKLIADYEGCRLQPYQCSAGVWTDGIG
NTSGVIPGKTITERQAAEGLISNVLRVERALERCVKQQPPQKVYDATVSFAFNVGTGNAC
SSTLVKLLNQRRWAEACRQLPRWVYVKGVFNQGLDNRRAREMAWCLKGAGL
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatcaatcgttaaacgctgccttgtcggggccgtgctggctattgctgccacg
ctgccggggtttcagcagcttcacacctccgtggaggggctgaaactgatcgccgattac
gaaggttgtcgtctgcagccgtatcagtgcagcgcgggtgtctggaccgacggcattgga
aatacgtcgggcgtcattcccggcaaaacaatcacggaacgacaggcagcagaagggctt
atttccaacgtgctgcgtgtggagcgggcgctggaaaggtgtgtgaagcaacagccgccg
cagaaggtatatgacgctacggtgtcgtttgccttcaacgtgggaacgggcaatgcctgc
agttctacgctggtgaaattgctcaatcagcggcgctgggcagaagcgtgccgacagttg
ccgcgctgggtttatgtgaaaggtgtgtttaatcaggggctggataaccgccgtgcgcgg
gagatggcctggtgccttaaaggagctggattatga

DBGET integrated database retrieval system