KEGG   Salmonella enterica subsp. enterica serovar Pullorum: I137_18410Help
Entry
I137_18410        CDS       T02790                                 

Definition
5-hydroxymethyluracil DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
seep  Salmonella enterica subsp. enterica serovar Pullorum
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:seep00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    I137_18410
Enzymes [BR:seep01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     I137_18410
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     I137_18410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3922657..3923466
Genome map
AA seq 269 aa AA seqDB search
MPELPEVETSRRGIEPHLVGATILHAHIRNGRLRWPVSDEIYRLSDTPVLSVQRRAKYLL
LELPDGWIIIHLGMSGSLRILSEALPAEKHDHVDLVMSNGKILRYTDPRRFGAWLWTKEL
EGHNVLAHLGPEPLSDEFNGEYLQQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAG
IHPDRLASSLSTEECDLLARVIKAVLLRSIEQGGTTLKDFLQSDGKPGYFAQELQVYGRK
GEPCRVCGTPIVATKHAQRATFYCRHCQK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacccgaagttgaaaccagccgccggggtattgaaccccatttagttggc
gctactatcctgcacgcccatatccgtaacggccgtctgcgctggccggtttcagacgaa
atttatcgtctgagcgatacacccgtccttagcgttcagcgtcgtgctaaatatttactg
ctggagctgcctgacggctggataattattcacctggggatgtcgggaagcttgcggata
ttgtcggaagcgctgccggcggaaaagcacgaccatgtcgatttggtgatgagcaacggc
aaaattctacgttataccgatcctcgccgctttggcgcctggttatggaccaaagagctg
gaagggcataacgtactggcgcatctgggaccggagccgctaagcgatgagtttaatggc
gaatatttgcagcagaaatgcgcgaagaagaagacggcgattaaaccctggctgatggat
aacaagctggtggtcggcgtggggaatatctacgccagcgagtcgctgtttgccgctggt
attcaccctgaccgcctggcgtcgtcactctcgacagaggagtgcgacctgctggcacgg
gtgattaaagccgttttgctgcgctctattgaacaaggcgggacaacgctgaaggatttt
ctgcaaagcgatgggaaaccgggctattttgcgcaggagttgcaggtgtacgggcgcaaa
ggcgagccgtgtcgggtatgcggtacgccgatagtcgcaacgaaacacgcacagcgtgcg
acgttctattgccgtcactgtcagaagtaa

DBGET integrated database retrieval system