KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_0407Help
Entry
UMN798_0407       CDS       T01782                                 

Gene name
hemB
Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
sef00860  Porphyrin and chlorophyll metabolism
sef01100  Metabolic pathways
sef01110  Biosynthesis of secondary metabolites
sef01120  Microbial metabolism in diverse environments
Module
sef_M00121  Heme biosynthesis, glutamate => heme
sef_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:sef00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    UMN798_0407 (hemB)
Enzymes [BR:sef01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     UMN798_0407 (hemB)
Exosome [BR:sef04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UMN798_0407 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: AFD57405
Position
complement(423161..424135)
Genome map
AA seq 324 aa AA seqDB search
MTDLIHRPRRLRKSAALRAMFEETTLSLNDLVLPIFVEEELDDYKAIDAMPGVMRIPEKQ
LAREIERIANAGIRSVMTFGISHHTDDTGSDTWKEDGLVARMSRICKQTVPEMIVMSDTC
FCEYTSHGHCGVLCEHGVDNDATLANLGKQAVIAAAAGADFIAPSAAMDGQVQAIRQALD
AAGFTDTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMNPMNRREAIRESLLDEAQG
ADCLMVKPAGAYLDVLREIRERTELPLGAYQVSGEYAMIKFAAMAGAIDEEKVVLESLGS
IKRAGADLIFSYFALDLAEKNILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccttatccatcgccctcgccgcctgcgcaaatccgctgcgctgcgcgctatg
tttgaagagacaacacttagcctgaacgacctggtgttgccgatctttgttgaagaagaa
ctcgacgattacaaagctattgatgccatgcccggcgtaatgcgtatcccggaaaagcag
ctggcgcgagagattgaacgtatcgcaaatgctggcattcgttccgttatgaccttcggc
atttctcaccatactgatgacaccggcagcgatacctggaaagaagacggtctggtggca
agaatgtcccgcatctgtaagcaaaccgtgccggagatgatcgtcatgtccgacacctgc
ttctgcgaatacacctcgcacggccactgcggcgtgttgtgcgaacacggtgtggataac
gatgcgacgctggccaacctcggcaagcaggccgttatcgcggcggcggctggagcagat
tttattgcgccctccgcggccatggatggacaagtccaggctatccgccaggcgctggat
gccgccggttttaccgatacggcaataatgtcctactccaccaagttcgcctcttctttc
tacggccctttccgtgaagcagcgggtaccgcgttaaaaggcgaccgcaagacgtatcaa
atgaatccgatgaaccgccgtgaagcgattcgcgaatcactgctcgacgaagcccagggc
gcggattgcttgatggtgaaaccggccggcgcgtatctggacgtgctgcgtgaaatccgc
gaacgcacagagttgccgcttggcgcttaccaggtgagcggtgaatacgccatgattaaa
tttgctgctatggctggcgccatcgatgaagaaaaggtcgtgctggaaagtctgggctcg
attaaacgcgccggcgccgatttgattttcagctacttcgcactggatctggctgagaaa
aatattctgcgttaa

DBGET integrated database retrieval system