KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_0407Help
Entry
UMN798_0407       CDS       T01782                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sef00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(423161..424135)
Genome map
AA seq 324 aa AA seqDB search
MTDLIHRPRRLRKSAALRAMFEETTLSLNDLVLPIFVEEELDDYKAIDAMPGVMRIPEKQ
LAREIERIANAGIRSVMTFGISHHTDDTGSDTWKEDGLVARMSRICKQTVPEMIVMSDTC
FCEYTSHGHCGVLCEHGVDNDATLANLGKQAVIAAAAGADFIAPSAAMDGQVQAIRQALD
AAGFTDTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMNPMNRREAIRESLLDEAQG
ADCLMVKPAGAYLDVLREIRERTELPLGAYQVSGEYAMIKFAAMAGAIDEEKVVLESLGS
IKRAGADLIFSYFALDLAEKNILR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccttatccatcgccctcgccgcctgcgcaaatccgctgcgctgcgcgctatg
tttgaagagacaacacttagcctgaacgacctggtgttgccgatctttgttgaagaagaa
ctcgacgattacaaagctattgatgccatgcccggcgtaatgcgtatcccggaaaagcag
ctggcgcgagagattgaacgtatcgcaaatgctggcattcgttccgttatgaccttcggc
atttctcaccatactgatgacaccggcagcgatacctggaaagaagacggtctggtggca
agaatgtcccgcatctgtaagcaaaccgtgccggagatgatcgtcatgtccgacacctgc
ttctgcgaatacacctcgcacggccactgcggcgtgttgtgcgaacacggtgtggataac
gatgcgacgctggccaacctcggcaagcaggccgttatcgcggcggcggctggagcagat
tttattgcgccctccgcggccatggatggacaagtccaggctatccgccaggcgctggat
gccgccggttttaccgatacggcaataatgtcctactccaccaagttcgcctcttctttc
tacggccctttccgtgaagcagcgggtaccgcgttaaaaggcgaccgcaagacgtatcaa
atgaatccgatgaaccgccgtgaagcgattcgcgaatcactgctcgacgaagcccagggc
gcggattgcttgatggtgaaaccggccggcgcgtatctggacgtgctgcgtgaaatccgc
gaacgcacagagttgccgcttggcgcttaccaggtgagcggtgaatacgccatgattaaa
tttgctgctatggctggcgccatcgatgaagaaaaggtcgtgctggaaagtctgggctcg
attaaacgcgccggcgccgatttgattttcagctacttcgcactggatctggctgagaaa
aatattctgcgttaa

DBGET integrated database retrieval system