KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_0552Help
Entry
UMN798_0552       CDS       T01782                                 

Gene name
tesA
Definition
acyl-coA thioesterase I
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:sef01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(565339..565953)
Genome map
AA seq 204 aa AA seqDB search
MNFNTVFRWHLPFLFLILLTFRAAAADTLLILGDSLSAGYRMAASAAWPSLLNDKWQNKT
SVVNASISGDTSQQGLARLPALLQQHHPRWVVVELGGNDGLRGFAPAQTEQTLRKIIQTV
KAADAQPLLMQIHLPANYGRRYNESFSAIYPKLAKEFDIPLLPFFMEEVYLKPQWMQDDG
IHPNRDAQPFIADWMAKQLTPFLS
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaacactgttttccgctggcatttgcccttcctgtttttgatcctgttaact
ttccgtgccgccgccgcagacaccttattaattctgggcgatagcctcagcgccggttac
cgtatggccgccagcgcggcatggccgtcgctccttaatgataaatggcaaaacaaaacg
tcggtcgttaatgccagtataagcggagatacctcgcagcagggactggcgcgtttgccg
gcgctgttgcaacagcatcacccgcgctgggtagtggtggaacttggcggcaacgatggc
ctacgcggttttgcgcctgcgcaaaccgaacagacgctacgtaaaatcattcagacggtg
aaagccgccgatgcccaaccgttactgatgcaaattcatctgcccgctaactacggtcgc
cgttataatgaatcctttagcgccatttatcctaagctcgccaaagagttcgatattcct
ctgttaccgttttttatggaagaggtatatctgaaaccgcagtggatgcaggatgacggc
attcatcccaaccgcgacgcccagccgtttattgccgactggatggcgaagcagttgacc
ccttttctctcctga

DBGET integrated database retrieval system