KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_0796Help
Entry
UMN798_0796       CDS       T01782                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase component (E2)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sef00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UMN798_0796 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UMN798_0796 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    UMN798_0796 (sucB)
Enzymes [BR:sef01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     UMN798_0796 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
803958..805166
Genome map
AA seq 402 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV
LEEEGTTVTSRQILGRLREGNSAGKETSAKSEEKASTPAQRQQASLEEQNNDALSPAIRR
LLAEHNLEASAIKGTGVGGRLTREDVEKHLAKGESKAPAVEPAAQPALGARGEKRVPMTR
LRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEVFEKRHGIRLGFMSFYVKAVV
EALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEKKIKELA
VKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVDGKVE
ILPMMYLALSYDHRLIDGRESVGFLVTIKELLEDPTRLLLDV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattcttgttcccgacctgcctgagtccgtagcggacgcgaccgtc
gccacctggcataaaaaaccgggcgatgcggttgttcgtgacgaagtgctggtagaaatc
gaaactgacaaagtggtactggaagtaccggcatcagcggacggcattctggatgcggtt
ctggaagaggaggggacgactgtcacctctcgccagatcctgggtcgcctgcgtgaagga
aacagcgcgggtaaagagaccagcgcgaaatctgaagagaaagcgtctacgccggcacag
cgccagcaggcgtcgctggaagaacaaaacaacgatgcgctcagcccggcgatccgtcgc
ctgctggctgaacacaatctggaagccagcgccattaaaggcactggtgtgggtgggcgt
ctgacccgtgaagatgtggaaaaacatctggcgaaaggcgagtctaaagcacccgctgtt
gaacctgcagcacaacccgctctgggcgcgcgcggcgaaaaacgcgtgccaatgacccgc
ctgcgcaagcgcgtggccgagcgtctactggaagcgaaaaattccaccgccatgctgacg
accttcaatgaagtcaacatgaagccgattatggatttgcgtaagcagtatggcgaagtg
tttgaaaaacgtcatggtatccgcctgggctttatgtccttctacgtgaaagcggtagtg
gaagcgctgaagcgttatccggaagtgaacgcctctatcgacggcgatgacgtggtgtat
cacaactactttgatgtgagcatggcggtgtctacgccgcgcggcctggtcacgccggtc
ctgcgtgacgtggatacgctgggcatggctgacatcgagaaaaaaattaaagaactggct
gtcaaaggccgcgacggcaagctgaccgtagaagacctgaccggtggtaactttaccatt
accaacggcggcgtattcggttcgctgatgtctaccccgatcatcaacccgccgcagagc
gcgattctgggaatgcatgctattaaagacaggccgatggcggtggatggcaaggtggaa
atcctgccgatgatgtacctggcgctctcttacgatcatcgcctgatcgatggtcgcgaa
tccgtgggcttcctggtcaccatcaaagagttgctggaagatccgacccgtctgctgttg
gacgtgtag

DBGET integrated database retrieval system