KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_1256Help
Entry
UMN798_1256       CDS       T01782                                 

Gene name
nagZ
Definition
Beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sef00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:sef00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1248834..1249847
Genome map
AA seq 337 aa AA seqDB search
MLNVEGCELDAEEREILAHPLVGGLILFTRNYHDPEQLRELVRQIRAASRNHLVVAVDQE
GGRVQRFREGFTRLPAAQSFFALHGLEEGGRLAQEAGWLMASEMIAMDIDISFAPVLDVG
HISAAIGERSYHADPAKALAMATRFIDGMHDAGMKTTGKHFPGHGAVTADSHKETPCDPR
PETDIRGKDMSVFRTLISENKLDAIMPAHVIYRAIDPRPASGSPYWLKTVLRQELGFDGV
IFSDDLSMEGAAIMGSYAERAQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERVTRLY
HKGSFSRRELMDSARWKTASAQLNQLHERWQEEKAGH
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatgtcgaaggatgtgagctggatgcggaggagcgcgagatactggcgcatccg
ctggttggcgggcttattctgttcacgcgtaattaccatgacccggaacagttgcgcgaa
ttagtgcgccagattcgggcggcatcgcgtaaccatctggtggtggccgtcgatcaggaa
ggcgggcgcgtacagcgtttccgtgaagggtttacccgcctgcccgcggcgcaatctttt
tttgcgctgcatgggctggaagagggggggcgactggcgcaggaggcagggtggctgatg
gccagcgaaatgatcgcgatggatattgatatcagttttgcgccagtgctggatgtcggg
catatcagcgcggcaattggcgagcgttcttatcatgccgatccagcaaaagcgttggca
atggcaacgcgctttattgacggcatgcatgacgccgggatgaaaacgaccggtaagcat
ttccccggccacggcgcggtcacggcggactcccacaaagagacgccgtgcgatccacgt
cctgaaacggacatccgtggcaaagatatgtcggtgttccgcacgctgattagcgagaat
aaactggatgcgattatgcctgcccacgtgatctaccgcgctatcgatccgcgtccggca
agcggttcgccgtactggctgaaaacggtgctgcgtcaggagttaggctttgatggcgtc
attttctccgacgatctgtcgatggagggcgcggcgattatgggcagctatgctgagcgc
gctcaggcgtcgctggatgcgggttgcgatatgattctggtctgcaataatcgtaaaggc
gcagtcagcgtgctggataatctgtcgccgatcaaagcagaacgtgttacacgtttgtat
cataaaggttcattttcacgccgggagctcatggactcagcacgctggaaaacagccagc
gcccagctcaaccagttacatgaacgctggcaggaagaaaaagcaggtcattaa

DBGET integrated database retrieval system