KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_1594Help
Entry
UMN798_1594       CDS       T01782                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sef00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sef00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:sef00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1559393..1560307
Genome map
AA seq 304 aa AA seqDB search
MDNAILETILQRVRPLIGQGKVADYIPALASVEGSKLGIAICTVDGQHYQAGDAHERFSI
QSISKVLSLVVAMRHYPEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGALVVC
DMLQGRLSAPRQRMLEVVRALCGVSDITYDATVARSEFEHSARNAAIAWLMKSFGNFHHD
VPTVLQNYFHYCALKMSCMELARTFVFLANQGEAFHLDEPVVTPMQARQINALMATSGMY
QNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDPAGNSLAGIAALEQLTQTLG
RSVY
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggataatgcaattttagagacgattttacagcgcgttcgccccctcattggccagggc
aaagtcgctgactatattccggcattagcgtccgtcgaaggttcaaagctggggatagcg
atttgtaccgtggacgggcagcattatcaggcgggcgatgcgcacgaacgcttctctatt
cagtctatttcgaaagtgctcagtctggtggtggcgatgcgtcattatccggaagaggag
atctggcagcgcgtcggaaaagatccttccggctcgccgttcaattcgttggttcagtta
gagatggaacaaggcatcccgcgtaatccatttattaatgcgggcgcgctggtggtatgc
gacatgttgcaaggccggcttagcgcgccgcgtcagcggatgctggaagttgtgcgcgcg
ctttgcggcgtatcggatattacgtatgacgctacggtcgcgcgctctgaatttgagcat
tccgcccgtaacgccgctattgcctggctgatgaaatcattcggtaattttcatcatgat
gtgcctaccgtgttgcaaaattactttcactactgtgcgttgaaaatgagctgcatggaa
ctggcgaggacgtttgtctttctggcgaatcagggcgaggcgtttcatctcgacgagccg
gtagtgacccccatgcaggcccggcagattaatgcgctaatggcgaccagcgggatgtat
cagaatgccggcgagtttgcctggcgggtgggattgcccgctaaatccggcgtgggcggc
ggtattgtcgccatagtgccgcatgaaatggcgattgccgtctggagtccggagctggat
cctgcgggaaactctctggcaggtatcgccgcgcttgagcaattaacacaaacgttagga
cgttcggtatactga

DBGET integrated database retrieval system