KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_1628Help
Entry
UMN798_1628       CDS       T01782                                 

Definition
LacI-family transcriptional regulator
Orthology
K02529  
LacI family transcriptional regulator
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1588894..1589874
Genome map
AA seq 326 aa AA seqDB search
MAGVSTATVSRVINQTAWVEPVTRERVEKAMRDLNYRRNAAAIALAKRSGDMLGLLTGNL
ADPFFARLARGVEDVSRKQQYRLMVCSGGHDEEMEKAGLDFLVNQGCEAIVVHASRLPDK
ELLRYAAHFPALVVVNRYIAGMANRCIWLENRSAAREATRYLLANGHRRIACVTSDLPII
DRQERLDGYREALEEYGISPDPRWVISVPFNEEGGERAAHQLINSGLPLTAAVTFNDVMA
AGIMRILHQRGVQLPQQLSIVGFDDVVLARYLYPALTTMHYPVEQMARCAAQLAIQLYQG
ITPPPSSNHFNAELVIRDSVAPYFSR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgtatcaaccgcgactgtatcacgcgtcattaaccagaccgcgtgggttgaa
cccgtcacgcgcgaacgtgtagagaaagccatgcgcgatctcaattatcgccggaatgcc
gccgctatcgcgctggcgaaacgcagcggcgatatgctcggattgttaaccggcaatctg
gctgatcctttttttgcccgccttgctcgcggcgtagaagatgtttctcgtaagcagcag
tatcgcttgatggtatgtagcggcggccacgacgaagaaatggaaaaagcgggactggat
tttctggttaatcaaggttgtgaggctattgttgtacacgccagccgattaccggataaa
gagctgctgcgctacgcagcccactttccagcgctggttgttgtgaatcgttatatagcc
ggtatggccaaccggtgtatctggctggaaaatcgcagcgccgccagggaagcgacccga
tatctcctggcgaacgggcatcggcgcattgcctgtgtgacatctgacttgccaattatt
gatcgtcaggaacgccttgatggttaccgtgaggcgctggaagaatatggtatttctcca
gaccctcgctgggtgattagcgttccgtttaacgaagaaggcggcgagcgggccgcgcat
caacttattaatagcgggcttccccttacggcagcggtcacgtttaacgatgtgatggcc
gctggcattatgcgtattcttcatcaacgcggcgttcagcttccgcaacagctctctatt
gtcggctttgatgatgtggtgctggcccggtatctttatccggcgttaacaacaatgcat
tatccggtcgaacaaatggcgcgttgtgccgcgcaactggcgatacagttataccagggc
attacgccgccgcccagcagcaatcatttcaatgccgaactggtgatccgcgattctgtc
gcgccctatttttcacggtga

DBGET integrated database retrieval system