KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_1997Help
Entry
UMN798_1997       CDS       T01782                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sef00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    UMN798_1997 (ruvA)
Enzymes [BR:sef01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     UMN798_1997 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1947004..1947567)
Genome map
AA seq 187 aa AA seqDB search
MLLETGGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLLYGFNNKQERTLFKELI
KTNGVGPKLALAILSGMSAQQFVNAVEREELGALVKLPGIGKKTAERLIVEMKDRFKGLH
GDLFTPAVDLVLTSPASPTSEDAEQEAVAALVALGYKPQEASRMVSKIARPDASSETLIR
DALRAAL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
gtgctgctggagacagggggcgtaggctatgaagtacatatgcctatgacctgcttttac
gagctgccggaggccgggcaggaggcaatcgtcttcacccacttcgtggtgcgtgaagat
gcgcagttgctgtacggatttaacaataagcaagagcgcacgctatttaaagagctaatt
aaaacgaatggcgtcgggcctaagctggcgctggcgatcctctccggcatgtcggcgcaa
cagttcgtcaatgcggttgagcgcgaagagcttggtgcgctggtgaagctgccgggtatc
ggcaagaaaactgccgaacgattgattgtcgaaatgaaagaccgctttaaagggctacat
ggcgatctctttacgccagcggtcgatctggtattgacgtcgccggccagcccaacctcg
gaagatgcagaacaagaagcagttgctgcgctggtggcgctgggttataaaccgcaagaa
gccagtcggatggtaagcaagatcgcccgtccggatgcaagcagtgaaacactgattcgc
gacgcgttacgcgccgcgttatga

DBGET integrated database retrieval system