KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_2934Help
Entry
UMN798_2934       CDS       T01782                                 

Gene name
nucD2
Definition
(RefSeq) lysozyme
  KO
K01185  
lysozyme [EC:3.2.1.17]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Brite
Enzymes [BR:sef01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     UMN798_2934 (nucD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(2868961..2869470)
Genome map
AA seq 169 aa AA seqDB search
MNPSIVKRCLVGAVLAIAATLPGFQSLHTSVEGLKLIADYEGCRLQPYQCSAGVWTDGIG
NTSGVVPGKTITERQAAQGLITNVLRVERALDKCVVQPMPQKVYDAVVSFAFNVGTGNAC
SSTLVKLLNQRRWADACHQLPRWVYVKGVFNQGLDNRRAREMAWCLKGV
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaatccttcaatcgttaagcgctgccttgtcggggcggtgctggctatcgccgccacg
ctgcccggatttcagtcgcttcatacctccgttgaggggctgaaactgatcgccgattac
gagggatgccgcctgcagccttatcagtgcagcgcgggcgtctggactgacgggatcggc
aatacgtccggtgtggtgcctggaaaaaccatcacggaacggcaggcggcgcagggactt
atcaccaacgtgctgcgcgtggagcgggcactggataaatgtgtggtacagccgatgccg
caaaaggtctatgacgcggtggtgtcgtttgctttcaacgtgggcaccggcaacgcctgc
agctccacgctggttaagttgctgaaccagcggcgctgggcggatgcctgccatcagctg
ccgcgctgggtatatgtcaaaggtgtgtttaatcaggggctggacaaccgccgcgcgcgg
gaaatggcctggtgcttaaaaggagtatag

DBGET integrated database retrieval system