KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_3316Help
Entry
UMN798_3316       CDS       T01782                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:sef00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UMN798_3316 (bglA)
Enzymes [BR:sef01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     UMN798_3316 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3229129..3230562
Genome map
AA seq 477 aa AA seqDB search
MRKLTLPKDFLWGGAVAAHQVEGGWNKDGKGPSICDVLTGGAHGVPREITQNVVAGKYYP
NHEAVDFYGHYKEDIRLFAEMGFKCFRTSIAWTRIFPNGDESQPNEAGLKFYDDMFDELL
KYNIEPVITLSHFEMPLHLVQHYGGWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNEIN
NQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAARRINPQMKVGCML
AMVALYPFSCKPEDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGDLE
VLREGTCDYLGFSYYMTNAVKAEGGSGDAISGFEGSVPNPYVKASDWGWQIDPVGLRYSL
CELYERYQKPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLMGY
TPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGEKL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaactcaccttgccaaaagattttttatggggcggcgcggttgctgcacaccag
gttgaaggcggctggaataaagacggtaaaggccccagcatctgcgacgtgctaaccggc
ggcgcacacggcgtgccacgcgaaatcacccagaatgtcgttgctggcaaatactatccg
aaccacgaggcggtggatttttacggacattacaaagaagacatccgtcttttcgccgaa
atggggttcaaatgcttccgtacctctattgcctggacgcgtatcttcccgaatggcgac
gaatcccagccaaacgaggccggtctgaaattctacgacgacatgtttgatgagttactc
aaatacaacatcgaaccggtcattaccctttctcactttgaaatgccattacatctggta
cagcactacggcggctggaccaatcgtaaagtggttgatttctttgtccgttttgctgaa
gtcgtgtttgaacgctacaaacataaggtcaaatactggatgaccttcaacgaaattaac
aaccagcgaaactggcgcgcgccgctgtttggctactgctgttccggcgtggtgtatacc
gagcatgagaatccagaagaaaccatgtatcaggtcttacatcatcagtttgtcgccagc
gcgctggcggtaaaagcggcacgtcgcattaacccacagatgaaagttggctgtatgctg
gcgatggtcgcgctgtatcctttctcctgtaaaccagaagatgtgatgtttgctcaggag
tcgatgcgtgaacgctacgtctttaccgatgtgcagctgcgcggctattacccgtcctat
gtgttgaacgagtgggagcgccgcggatttaacatcaaaatggaagatggcgatcttgaa
gtgctgcgcgaaggcacctgcgattatcttggtttcagttattacatgaccaacgcggtc
aaagccgaaggcggtagcggcgatgcgatttccggttttgaaggcagcgtaccgaacccc
tatgttaaagcatctgactggggctggcagattgacccggtgggcctgcgttattcattg
tgtgaactgtacgaacgctatcaaaagccgctgtttattgtcgaaaacggttttggtgct
tacgacaaagtagaagaagatggcagcatcaacgacgactaccgaattgactacctgcgc
gcccatattgaagagatgaaaaaagcggtgacttacgatggtgtcgacctgatgggctac
acgccgtggggctgcatcgactgcgtgtcgttcaccaccggtcagtacagcaagcgctac
ggcttcatctacgtgaacaagcacgatgacggtacgggcgatatgtcgcgttcgcgtaag
aagagcttcaactggtacaaagaggtgattgccagcaacggcgagaagctttaa

DBGET integrated database retrieval system