KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_3669Help
Entry
UMN798_3669       CDS       T01782                                 

Gene name
mreB
Definition
rod shape-determining protein
Orthology
K03569  
rod shape-determining protein MreB and related proteins
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3564037..3565080)
Genome map
AA seq 347 aa AA seqDB search
MLKKFRGMFSNDLSIDLGTANTLIYVKGQGIVLNEPSVVAIRQDRAGSPKSVAAVGHDAK
QMLGRTPGNIAAIRPMKDGVIADFFVTEKMLQHFIKQVHSNSFMRPSPRVLVCVPVGATQ
VERRAIRESAQGAGAREVFLIEEPMAAAIGAGLPVSEATGSMVVDIGGGTTEVAVISLNG
VVYSSSVRIGGDRFDEAIINYVRRNYGSLIGEATAERIKHEIGSAYPGDEVREIEVRGRN
LAEGVPRGFTLNSNEILEALQEPLTGIVSAVMVALEQCPPELASDISERGMVLTGGGALL
RNLDRLLMEETGIPVVVAEDPLTCVARGGGKALEMIDMHGGDLFSEE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaaatttcgtggcatgttttccaatgacctgtccattgacctgggtaccgcg
aataccctcatttatgtaaaaggacaaggcatcgtattgaatgagccttccgttgtggcc
attcgtcaggatcgtgccggttcgccgaaaagcgtggctgcagtcggtcatgatgcgaag
cagatgctgggccgtacgccgggcaatatcgctgcgatccgtccgatgaaagacggcgtt
atcgctgacttctttgtgaccgaaaaaatgctccagcactttattaaacaagtgcacagc
aacagctttatgcgcccaagcccgcgcgtactggtatgcgtgccggtcggcgcgacgcag
gtagaacgccgcgcaattcgtgaatccgctcagggcgcaggcgcccgtgaagtctttttg
atcgaagagccgatggcggccgcgatcggcgcaggtctgccagtttctgaagcaaccggt
tcaatggttgtggatatcggtggtggtaccactgaagttgccgtgatctccctgaacggc
gtggtttactcttcttctgtccgtattggtggtgaccgtttcgacgaagccatcattaat
tacgttcgtcgtaactacggttctctgattggtgaagccaccgcagaacgtattaaacac
gaaatcggttccgcttatccgggcgacgaagtccgcgagatcgaagtgcgtggccgtaac
ctggcggaaggcgttccacgcggctttaccctgaactcaaacgagattctggaagcgttg
caggaaccgttgaccggtatcgtcagcgcggtaatggtggcgctggaacagtgtccgccg
gagctggcgtcagacatctccgagcgcggtatggtgctcaccggcggcggcgcgctgctg
cgtaaccttgaccgtctgttaatggaagagacgggcattcctgtcgtggttgctgaagat
ccgctgacctgtgtggcgcgcggcggcggcaaggcgctggaaatgatcgatatgcacggc
ggcgacctgttcagcgaagagtag

DBGET integrated database retrieval system