KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_3831Help
Entry
UMN798_3831       CDS       T01782                                 

Definition
hypothetical protein
Orthology
K02040  
phosphate transport system substrate-binding protein
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
ABC transporters
Two-component system
Module
Phosphate transport system
Brite
KEGG Orthology (KO) [BR:sef00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    UMN798_3831
  Signal transduction
   02020 Two-component system
    UMN798_3831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3710992..3712452)
Genome map
AA seq 486 aa AA seqDB search
MAFIGVPLLVNIITIIVGGMWAYISVLENSIPVARSIEEATIIPVALLGAGLIFLCGRIW
GKGNASEVNPEWRDCCLLMPALVVLMGWVILMFLTDLNIRAIGCKPIAQVVQTLWLVPRV
ISFFNGWVWAVLLIPVGSQLCFALGYGGARWGVLRGGAGYTCRNLLVICLLFFGSCAVYQ
SHLYAVKYPAPESSEYLYFRDYQAHTWGNKLTGLRDEPTLLLTQNWPRLDGATAGLPLYA
SAFYALTRFPDDICPEDYLENQGTIEAYQNILNGNADLIFVAQPSTAQKQLAEASGVKLV
YTPFAREAFVFIVNQNNPVSSLSDVQIRGIFSGRITHWNEVGGEAIDIKPWQRPENSGSQ
TAMLAKVMKETKLMPAQTTSVATAMGDMVDIVAEYRNTHNAIGYTFRYYATQMHSNKEIK
LLAINDVAPTVENIRNGSYPYTVDVYMVTREHPTAETQKLVDWFLSPQGQQLVQDVGYVP
LYPAAK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttatcggcgtgccgctgctggtgaacattattacgattatcgtggggggaatg
tgggcgtacattagcgttcttgaaaatagtatccccgtcgcgcgatctattgaggaggcg
accattatcccggtagcgcttctgggcgcagggttaatttttctttgtggccggatatgg
ggaaagggaaatgcatcagaggtaaatccagaatggcgtgattgctgcctgcttatgccc
gctctggtggtgctgatggggtgggtcatcctgatgtttctcaccgatcttaatattcgc
gcgatagggtgtaagcccatcgcccaggtggtgcaaacgctttggttagtaccccgcgta
atatcctttttcaacggctgggtatgggcagtgttgctcatcccggttggctcgcagctc
tgttttgcattagggtatggcggtgcgcgttggggagtgctacgcggcggtgcgggctac
acttgtcgtaacctgctggtgatttgcctgctgtttttcgggagctgtgccgtataccag
tcacatctttatgccgtgaagtatcccgctcccgagagcagtgaatatctttatttccgc
gattatcaggcgcacacatggggcaacaagctaaccgggctgcgcgatgaaccgacactt
ttgctcactcaaaattggccgcggctcgatggcgcaacggctggcttgccgttatacgcc
tcggctttttatgcgcttacgcgctttccggatgatatctgccctgaagactaccttgaa
aaccagggaaccattgaagcctatcaaaatatccttaacggtaatgccgatcttattttt
gtcgcccagccttccactgctcaaaagcaattggccgaggccagtggcgtaaaactggtt
tacaccccctttgcacgtgaagcgtttgtgtttatcgtcaaccaaaacaatcccgtgtca
tcgttgagtgatgtacaaattcgcggcatttttagcggaagaatcacccactggaatgag
gtgggcggagaggcaatcgacattaagccctggcagcgaccggaaaactctggcagccaa
acggcgatgctggcgaaggtaatgaaagaaacgaagctgatgccagcgcaaacaacatca
gtggcaaccgcgatgggggatatggtggatatcgtggctgagtatcgcaatacgcacaac
gccattggctatacctttcgttattacgctacgcagatgcacagcaataaagagattaaa
ttactggcgataaacgatgttgcgccgacggttgaaaatattcgtaacggcagttacccg
tacacggttgatgtttatatggtcacccgtgaacaccccacagcggaaacacaaaagctg
gtggactggtttctaagcccgcagggacaacagttggtgcaggatgtgggatatgtgccg
ctgtatccggccgcgaaataa

DBGET integrated database retrieval system