KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_4062Help
Entry
UMN798_4062       CDS       T01782                                 

Gene name
gmk
Definition
5'guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sef00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    UMN798_4062 (gmk)
Enzymes [BR:sef01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     UMN798_4062 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3953239..3953862
Genome map
AA seq 207 aa AA seqDB search
MAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRAPRPGEVHGEHYFFVNHD
EFKTMIGREAFLEHAEVFGNYYGTSRETIEQVLATGVDVFLDIDWQGAQQIREKMPQARS
IFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALSDLK
TIIRAERLRMSRQKQRHNALISKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaggtacgctttatattgtttctgcccccagtggcgcgggtaaatccagcctg
attcaggctttattaaaaacccaaccgttgtatgacactcaggtttccgtttcacatacc
acgcgcgcgccgcgtccgggtgaagtgcacggtgagcactatttctttgtaaatcatgat
gagtttaaaaccatgattggcagggaggcgtttctggagcacgcggaagtgtttggcaat
tactacggcacttcgcgcgaaaccattgagcaagtgctggcaaccggcgttgatgttttt
ctggatatcgactggcagggcgcccagcaaattcgcgaaaagatgccgcaagcacgcagc
atttttattttgccgccgtcaaagatcgaattggatcgccgtttacgcggccgcgggcaa
gatagcgaagaagtcattgccaaacgaatggcgcaagcggttgcagaaatgagccattac
gccgaatatgattatcttattgtgaatgacgactttgataccgcgttaagcgacttgaaa
accatcattcgcgctgaacgtctgcgtatgagccgccaaaagcagcgtcataacgcttta
atcagcaaattgttggcagactga

DBGET integrated database retrieval system