KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_4103Help
Entry
UMN798_4103       CDS       T01782                                 

Definition
glycosyl hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sef00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3996085..3997467
Genome map
AA seq 460 aa AA seqDB search
MRYRFPDNFWWGSACSALQTEGDSLNGGKSQTTWDVWFERQPGRFHQGVGPAETSTFYRH
WKQDIALLKQLKHNSFRTSLSWARLIPDGVGEVNPQAVSFYNHVIDELLAQGITPFITLF
HFDMPMVMQEKGGWENRDVVEAFGRYAQTCFTLFGDRVKHWFTFNEPIVPVEGGYLYDFH
YPNVVDFKRAATVAYHTVLAHSTAVRAWRAGRYDGEIGIVLNLTPSYPRSQHPADVQAAH
HADLLFNRSFLDPVLKGEYPADLVALLKTYDQLPACQPGDRQLIADGKIDLLGINYYQPR
RVKCRDTAVNPQAPFMPEWLFDYYDMPGRKMNPYRGWEIYAPGIYDIITNLRDNYGNPRC
FISENGMGVENEQRFVQAGQIHDDYRIDFISEHLKWLHKGISEGCHCLGYHMWTFIDNWS
WLNGYKNRYGFVQLDLATQTRTVKKSGEWFAATAEHNGFD
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgcgataccgttttcccgataacttctggtggggcagcgcctgctcagcgttgcaaacc
gaaggggatagtctgaatggcggtaaaagccagaccacgtgggatgtgtggttcgagcgc
cagccgggtcgttttcaccagggcgtcggtccagcggaaacctcaacgttctatcgccac
tggaagcaagacatcgcgctactgaaacagttaaaacataacagttttcgcacctcgcta
agctgggcgcggctcattccagacggcgtaggcgaggtgaatccacaagcggtgagcttc
tacaatcacgtcatcgacgagctactggcgcagggcatcacgccgtttattacgctgttc
cattttgatatgccgatggtcatgcaggagaaaggcggctgggaaaatcgcgacgtcgta
gaggcgtttggtcggtacgcgcaaacgtgttttaccttgtttggcgaccgcgtgaagcac
tggtttacctttaacgagccgattgtgccggtggaaggcggctatttgtacgacttccac
tatcccaatgtggtggattttaaacgggcggccaccgtggcgtaccataccgtgctggcg
cactcgaccgccgtgcgcgcctggcgcgccgggcgctacgacggtgaaatcggcatagta
ctgaatctgacgccgtcctacccacgctcgcagcatcccgccgatgtgcaagccgcgcac
catgcggatctgttattcaaccgcagttttcttgacccggtattaaagggagaatacccg
gcggacttggtggcgctgctgaaaacctatgaccagttgcctgcctgtcagccaggcgac
cgtcagcttattgccgacggcaaaatcgatttactggggattaactattatcagccgcgc
cgcgtgaaatgccgtgatacggcggtgaatccgcaagcgccgtttatgccggagtggtta
tttgactattacgacatgccggggcgcaagatgaacccttaccgcggctgggaaatttac
gcgccaggaatttacgacatcatcaccaacctgcgggataattacggcaatccgcgctgt
tttatctccgaaaacgggatgggcgttgagaacgagcagcgttttgtgcaagcgggacag
attcacgatgattaccggattgactttatttctgagcatcttaaatggctgcataaaggc
attagcgagggctgtcactgtcttggctaccacatgtggacctttatcgataactggtca
tggctgaacggctataaaaatcgctatggttttgtacaactggatttagccacccaaacg
cgcacggtgaaaaaaagcggagaatggtttgccgccaccgcagagcataacggttttgat
taa

DBGET integrated database retrieval system