KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_4321Help
Entry
UMN798_4321       CDS       T01782                                 

Gene name
fadB
Definition
large (alpha) subunit of the fatty acid-oxidizing multienzyme complex
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sef00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UMN798_4321 (fadB)
   01212 Fatty acid metabolism
    UMN798_4321 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    UMN798_4321 (fadB)
   00650 Butanoate metabolism
    UMN798_4321 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    UMN798_4321 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    UMN798_4321 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    UMN798_4321 (fadB)
   00310 Lysine degradation
    UMN798_4321 (fadB)
   00380 Tryptophan metabolism
    UMN798_4321 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    UMN798_4321 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    UMN798_4321 (fadB)
   00281 Geraniol degradation
    UMN798_4321 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    UMN798_4321 (fadB)
Enzymes [BR:sef01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     UMN798_4321 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     UMN798_4321 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     UMN798_4321 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     UMN798_4321 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4209452..4211767)
Genome map
AA seq 771 aa AA seqDB search
MISAERDHIGISLIIYLHFFNTKYTLRFIWYDQITLWIQETDMLYKGDTLYLDWLEDGIA
ELVFDAPGSVNKLDTATVASLGQALEVLEKQHDLKGLLLRSNKAAFIVGADITEFLSLFL
VPEEQLSQWLHFANSVFNRLEDLPVPTLAAVNGYALGGGCECVLATDYRLATPDLRIGLP
ETKLGIMPGFGGSVRLPRMLGADSALEIIAAGKDVGAEHALKIGLVDGVVKQEKLIEGAI
AVLRQAITGDLDWRAKRQPKLEPLKLSKIEAAMSFTIAKGMVAQTAGKHYPAPMTAVKTI
EAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVKGKAKKLTKDIETPKQAAV
LGAGIMGGGIAYQSAWKGVPVIMKDINDKSLNLGMTEAAKLLNKQLERGKIDGLKLAGVI
STIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQKVRPETVLASNTSTIPIGELAS
ALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAWASKMGKTPIVVNDCPGFF
VNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYLLDVVGIDTAHHAQAVMAA
GFPQRMQKDYRDAIDALFDASRFGQKNGLGFWRYKEDSKGKPKKEEDAAVDDLLASVSQP
KRDFSDDEIIARMMIPMINEVVRCLEEGIIASPAEADMALVYGLGFPPFHGGAFRWLDTQ
GSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPPVEPARPVGSLKTA
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
gtgatctctgccgagcgtgatcacatcggcatttctttaatcatttatttgcattttttt
aacacaaaatacacacttcgcttcatctggtacgaccagatcactttgtggattcaggag
actgacatgctttataaaggcgacaccctgtacctcgactggctggaagatggcatcgcc
gaactggtgttcgatgctccaggctcggtcaataaactcgacaccgcaaccgtcgccagc
ctcggccaggcgcttgaggtgctggaaaagcaacacgatttaaaagggctgctgctgcgc
tctaataaagcggcctttattgtcggcgcggacatcaccgaatttctttcactgttcctc
gtccccgaagagcagttaagccaatggctgcatttcgctaatagcgtctttaaccgtctg
gaagatttacccgtaccgacccttgccgccgtaaacggctatgcgctgggcggcgggtgc
gaatgcgtgctggccaccgattaccgtctggcgacgccagacctccgtatcggtctgccg
gaaactaaactgggcatcatgccgggtttcggcggctccgttcgtctgccgcgtatgctg
ggcgcagacagcgcgctggagattatcgcggcaggtaaagatgtcggtgctgagcacgcg
ctgaaaatcggccttgtggacggcgtggtcaaacaagagaagctaattgaaggcgcgata
gcggtgttacgccaggccattaccggcgatctcgactggagagctaaacgccagccgaaa
ctggaaccgttgaaactcagtaagattgaagcagcgatgagctttaccatcgctaaaggc
atggtcgcacaaacggcgggtaaacattatccggcgccgatgaccgcagtgaaaaccatt
gaagccgccgcgcgttttggtcgtgaagaagcgctgaatctggaaaataaaagctttgtt
ccgctggcgcataccaatgaggctcgtgcgctggtcggtatcttcctcaacgatcaatat
gtaaaaggtaaagccaaaaagctgaccaaagatattgagacgccgaaacaggcagccgta
ctgggcgcgggcattatgggcggcggtatcgcttaccagtcggcctggaaaggcgtaccg
gtcatcatgaaagatatcaacgataaatcgttgaacctcggcatgaccgaagcggccaag
ctgctgaacaaacagctggagcgcggcaagatcgacggtctgaagctggcgggcgtcatt
tcgaccatccacccgactctcgattatgccggtttcgatcgcgtagatgttgttgtcgaa
gcggtagtcgaaaatccgaaagtcaaaaaagcggtactggcggaaaccgagcagaaagtg
cgcccggaaaccgtgctggcctcaaatacctccaccatcccaattggcgaactggcaagc
gccctggaacgtccggaaaacttttgcggaatgcacttcttcaacccggtacaccggatg
ccgctggttgaaatcattcgcggcgagaagagttcagacgaaaccattgccaaagtcgtc
gcctgggccagcaaaatgggcaagacaccgattgtagtcaacgactgccccggcttcttt
gttaaccgcgtgctgttcccctatttcgccggtttcagtcaactgctgcgcgacggcgcg
gatttccgcaaagtcgataaagtgatggaaaaacagttcggctggccgatgggcccggcc
tatctgctcgacgtggtgggtattgataccgcccaccacgcgcaggcagtaatggcggca
ggcttcccacagcgtatgcagaaagattaccgcgacgcgatcgacgcattgtttgacgcc
agccgttttgggcaaaaaaacggtctgggcttctggcgctataaagaagacagcaagggt
aagccgaagaaagaagaagatgccgcggtggatgacctgctggcaagcgtcagccagccg
aaacgcgacttcagcgacgacgagataatcgcccgtatgatgatcccgatgattaacgaa
gtggttcgctgtctggaagaaggcattatcgcaagcccggcggaagccgatatggcgctg
gtctacggcctgggcttccctccgttccacggcggcgcattccgctggctggatacacag
ggcagcgcgaaatatcttgatatggcgcagcagtatcaacacctcggcccgctgtatgag
gtgccggaagggctgcgtaataaagcgcgccataacgaaccgtattatcccccggttgaa
ccagcccgtccggttggttctctgaaaacggcttaa

DBGET integrated database retrieval system