KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_4424Help
Entry
UMN798_4424       CDS       T01782                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
sef00010  Glycolysis / Gluconeogenesis
sef00051  Fructose and mannose metabolism
sef00562  Inositol phosphate metabolism
sef01100  Metabolic pathways
sef01110  Biosynthesis of secondary metabolites
sef01120  Microbial metabolism in diverse environments
sef01130  Biosynthesis of antibiotics
sef01200  Carbon metabolism
sef01230  Biosynthesis of amino acids
Module
sef_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sef_M00002  Glycolysis, core module involving three-carbon compounds
sef_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sef00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UMN798_4424 (tpiA)
   00051 Fructose and mannose metabolism
    UMN798_4424 (tpiA)
   00562 Inositol phosphate metabolism
    UMN798_4424 (tpiA)
Enzymes [BR:sef01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     UMN798_4424 (tpiA)
Exosome [BR:sef04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   UMN798_4424 (tpiA)
  Exosomal proteins of bladder cancer cells
   UMN798_4424 (tpiA)
  Exosomal proteins of melanoma cells
   UMN798_4424 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF3254
Motif
Other DBs
NCBI-ProteinID: AFD60904
Position
complement(4310255..4311004)
Genome map
AA seq 249 aa AA seqDB search
MGNWKLNGSRHMVNELVANLRKELTGVAGCDVAIAPPEMYIDLAKRAAAGSHIMLGAQNV
DLNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLC
IGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATPAQAQAV
HKFIRDHIAKADAKIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKADAFAVIV
KAAEAAKQA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgggtaactggaaactgaacggcagccgccacatggtaaacgaactggtggctaacctg
cgtaaagaactgacgggcgtagcaggctgcgacgtggcaatcgctccgccggaaatgtat
atcgatctggcgaaacgcgctgctgccggcagccacatcatgctgggcgcgcagaacgtt
gatctgaatctgtctggcgcattcaccggtgaaacttcggctgaaatgctgaaggatatc
ggcgcgcagtacattattatcggccactccgagcgtcgtacttatcacaaagaatctgac
gagctgatcgccaaaaaattcgccgtactgaaagaacaaggtctgacgccggtactgtgc
atcggtgaaaccgaagcggaaaacgaagcgggcaaaacagaagaagtatgcgcacgccag
atcgacgcggtactgaaaacgcagggcgcggcagcctttgaaggcgcggttatcgcttac
gaacccgtatgggcgatcggtaccggtaaatctgcaactcctgcgcaggcgcaggcagtg
cacaaattcatccgtgaccacattgctaaagctgacgcgaaaatcgctgaacaggttatt
atccagtacggcggttctgttaatgcctccaacgccgccgaactgttcgcgcagccggac
atcgacggcgcactggtaggcggcgcttctctgaaagctgacgccttcgcggtgatcgtg
aaagcagcagaagctgctaaacaggcttaa

DBGET integrated database retrieval system