KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_4533Help
Entry
UMN798_4533       CDS       T01782                                 

Gene name
aceB
Definition
malate synthase A
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sef00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UMN798_4533 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    UMN798_4533 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    UMN798_4533 (aceB)
Enzymes [BR:sef01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     UMN798_4533 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4421986..4423590
Genome map
AA seq 534 aa AA seqDB search
MMNPQATTTDELTFTRPQGELEKQVLTAEAVEFLTELVTRFTPKRNKLLAARIQQQQDID
NGKLPDFISETTSIRESNWQIRGIPADLQDRRVEITGPVERKMVINALNANVKVFMADFE
DSLAPDWNKVIDGQINLRDAVNGTISYTNEAGKIYQLKPDPAVLICRVRGLHLPEKHVTW
RGEAIPGSLFDFALYFFHNYKALLAKGSGPYFYLPKTQAWQEAAWWSEVFSYAEDRFNLP
RGTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQ
VVTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDVERNNQVLAKVKADKALEANN
GHDGTWIAHPGLADTAMAVFNEVLGEHKNQLFITRDEDAPITAEQLLEPCEGERTEAGMR
ANIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHEKTLSNGKPVTKTLF
REMLAEEMRVIQDELGEHRYSSGRFDDAARLMEQITTSDDLIDFLTLPGYRLLA
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatccacaggcaaccacaactgatgaattaacctttaccaggccgcaaggcgag
ctggaaaagcaagtcctgaccgctgaagcagtcgagtttttgacggagttagtcacccgt
tttacgccaaaacgcaataaactcctggctgcccgtatccagcaacagcaggatattgat
aacggtaagttgcctgattttatttcggaaaccacttccattagagaaagtaattggcag
attcgtggtattccggcggatttacaggatcgccgagtagaaattaccgggccggttgaa
cgtaaaatggtgattaatgccctgaacgcaaatgtgaaagtgtttatggcggattttgaa
gactcgctggcgccggactggaataaagttattgatggtcaaatcaacctgcgtgatgcg
gtgaacggcaccattagctataccaacgaagccggaaaaatctatcagctcaagcccgat
ccggccgtattgatttgtcgtgtacgtggtctacatctgccagaaaaacatgttacctgg
cggggggaagccattcccggcagcctgtttgattttgctctgtactttttccacaactat
aaagcgctgctcgctaaaggtagcggcccgtatttttacctgccgaaaacgcaagcctgg
caggaggcagcctggtggagcgaagtgttcagctacgccgaagaccgctttaacctgccg
cgcggtacgatcaaagcgaccctgttgattgaaacgctgccggctgttttccagatggat
gagattcttcatgcgctgcgtgatcatatcgtcggtctcaactgtggtcgctgggattat
attttcagctatatcaaaacgttgaaaaatcacccggatcgcgttttgccggacaggcag
gtggtaacgatggacaaaccgtttctgagcgcctactcgcgcctgctgatcaaaacctgc
cacaagcgcggcgcgttcgcgatgggcggtatggcggcgtttatcccgagcaaagacgtt
gaacgcaacaatcaggtccttgccaaagtgaaagcggataaagcgctggaagcgaacaac
ggccacgacggcacgtggattgcgcatcctgggttggcggataccgcaatggccgtcttt
aacgaggtactgggcgagcacaaaaatcagctgttcattacccgtgatgaagatgcgccg
attaccgctgaacagttactggagccatgtgaaggcgaacgcacagaagcgggaatgcgc
gccaatattcgcgtggcagtgcagtacattgaagcgtggatctccggcaatggctgtgta
ccgatttacggtctgatggaggatgccgcgacggcggaaatctcacgaacctctatctgg
cagtggattcaccatgagaaaacactgagcaatggaaaacccgtaacgaaaacgcttttc
cgcgaaatgttggcggaagagatgcgggtaatccaggacgaactgggcgagcaccgctac
agcagcgggcgcttcgacgatgccgcacgtctgatggagcaaatcaccacctcagatgac
ttaatcgacttcctcaccctgccgggctatcgcttactggcttaa

DBGET integrated database retrieval system