KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_4534Help
Entry
UMN798_4534       CDS       T01782                                 

Gene name
aceA
Definition
(RefSeq) isocitrate lyase
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sef00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UMN798_4534 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    UMN798_4534 (aceA)
Enzymes [BR:sef01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     UMN798_4534 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
4423607..4424926
Genome map
AA seq 439 aa AA seqDB search
MEHLHMKTRTQQIEELQKEWTQPRWEGITRPYSAEEVVKLRGSVNPECTLAQLGAAKMWR
LLHGEAKKGYINSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASSMYPDQSLYPAN
SVPAVVDRINNTFRRADQIQWASGIEPNDPRYVDYFLPIVADAEAGFGGVLNAFELMKSM
IEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTLVIARTDA
DAADLITSDCDPYDSGFITGERTSEGFYRTHAGIEQAISRGLAYAPYADLVWCETSTPDL
ELARRFADAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKYQFITLAGI
HSMWFNMFDLAHAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTII
QGGASSVTALTGSTEEAQF
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggagcatctgcacatgaaaacccgtactcaacaaatcgaagaattacagaaagagtgg
acacaaccgcgctgggaaggcatcacccgcccgtacagcgcggaggaggtggtgaaatta
cgcggctcggttaacccggaatgcacgctggcgcagctcggcgccgcgaaaatgtggcgg
ctgttgcacggtgaagcgaaaaaaggctatatcaacagccttggcgcgctgaccggcggt
caggcgttgcagcaggcgaaagccggtattgaggcgatttatctttcaggctggcaggtg
gcggcagatgccaacctggcatccagcatgtatccggatcaatcgttgtacccggcaaac
tctgttccggcggtagtggatcggatcaacaacacttttcgtcgtgcagatcagatccag
tgggcatccggtattgaacccaacgatccgcgctatgtggattacttcctgccgatcgtt
gctgatgcggaagccggttttggcggcgttctgaatgccttcgaactgatgaaatcgatg
attgaagccggtgcagcggccgttcacttcgaagatcagctggcgtcggtgaagaaatgc
ggccatatgggcggcaaggtgctggtccccacgcaggaggcgattcagaaactggttgct
gcgcgtctggccgctgatgtgatgggcgtcccgacgctggtgattgcgcgtaccgatgcg
gatgcggcagatctgatcacctccgactgcgatccctatgacagcggttttattaccggc
gaacgcaccagcgaaggtttctaccgcacccatgcgggcattgagcaggcgatcagccgc
ggtctggcgtatgccccgtatgccgatctggtatggtgcgaaacctctacgccggatctc
gaactggcgcgtcgttttgccgatgctatccacgcgaagtatccgggcaaactgctggcc
tataactgttcaccatccttcaactggcagaagaatctggacgacaagaccattgccagc
ttccagcagcagttgtcggacatgggttacaaataccagtttattaccctggcgggcatc
cacagcatgtggttcaacatgttcgacctggcgcatgcatacgcgcagggcgagggcatg
aagcactatgttgagaaggttcaacaacccgagttcgccgcggcgaaagatggctacacc
tttgtttcccaccagcaggaagtgggtactggttacttcgacaaagtcaccaccattatt
cagggcggcgcgtcatccgttaccgcgttaacgggttccaccgaagaagcgcagttttga

DBGET integrated database retrieval system