KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_4633Help
Entry
UMN798_4633       CDS       T01782                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
sef00010  Glycolysis / Gluconeogenesis
sef00620  Pyruvate metabolism
sef00640  Propanoate metabolism
sef00680  Methane metabolism
sef01100  Metabolic pathways
sef01110  Biosynthesis of secondary metabolites
sef01120  Microbial metabolism in diverse environments
sef01130  Biosynthesis of antibiotics
sef01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sef00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UMN798_4633 (acs)
   00620 Pyruvate metabolism
    UMN798_4633 (acs)
   00640 Propanoate metabolism
    UMN798_4633 (acs)
  Energy metabolism
   00680 Methane metabolism
    UMN798_4633 (acs)
Enzymes [BR:sef01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     UMN798_4633 (acs)
Lipid biosynthesis proteins [BR:sef01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   UMN798_4633 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFD61077
Structure
PDB: 

Jmol
Position
complement(4533667..4535625)
Genome map
AA seq 652 aa AA seqDB search
MSQTHKHAIPANIADRCLINPEQYETKYKQSINDPDTFWGEQGKILDWITPYQKVKNTSF
APGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDTSQSKHISYRELHRDVCRF
ANTLLDLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSSS
RLVITADEGVRAGRSIPLKKNVDDALKNPNVTSVEHVIVLKRTGSDIDWQEGRDLWWRDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKCPVVDTWWQTETGG
FMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaacacataaacacgccattcccgccaacattgcggatcgttgcctgataaat
ccagagcagtatgagactaaatataaacagtctattaacgatcccgatacgttttggggc
gaacagggaaaaattctcgattggatcacgccgtaccaaaaagtgaaaaacacctccttt
gcgccaggcaatgtgtcgattaaatggtacgaggacggcacgctgaatctggcggcgaac
tgtcttgaccgccatttgcaggaaaatggcgatcgcaccgccattatctgggaaggcgat
gacacgtcgcagagtaaacatatctcttatcgcgaactgcatcgcgatgtctgccgtttc
gcgaatacgctgctggatctgggcattaaaaaaggcgatgtggtagcgatttatatgccg
atggtgccggaagcggcggtggcaatgttggcctgcgcccgcatcggtgcggtgcattcg
gtgatcttcgggggcttctcgccggaagccgtcgccggacgcattatcgactccagctcg
cggctggtgatcaccgctgacgaaggtgtacgtgccggacgcagtatcccgctgaaaaag
aatgtcgatgacgcgctgaaaaacccgaatgtcactagcgttgagcatgtgatcgtcctg
aagcgcaccggcagcgacattgactggcaagaaggccgcgacctgtggtggcgcgatttg
attgaaaaagccagccctgagcaccagcctgaagcgatgaatgccgaagatccgctgttt
atcctttatacctccggctccaccggcaagccgaaaggcgtgctgcacaccaccggcggc
tatctggtctacgccgcgaccacctttaagtatgtctttgattatcaccctggcgatatt
tactggtgtaccgccgatgtgggttgggtgacggggcacagctatctgttgtatggcccg
ctggcctgcggcgcgaccaccttaatgtttgaaggcgtgccgaattggccaacgcccgct
cgcatgtgccaggtggtcgacaaacaccaggtcaacattctctataccgccccgacggcc
atccgcgcgctgatggcggaaggcgataaagccattgaaggcaccgaccgttcttcactg
cgcattctgggttccgtcggcgagccgatcaatcccgaagcgtgggaatggtactggaag
aagatcggcaaggaaaaatgtccggtcgtcgacacctggtggcagactgaaacaggcggt
tttatgatcacgccgctaccaggcgctatcgaactgaaagccggttccgccacccgtcct
ttctttggcgtacagcctgcgctggtggataacgaaggccatccgcaagaaggcgcgacg
gaaggcaatctggtcatcaccgattcctggccgggccaggcgcgcactctgttcggcgat
catgaacgttttgagcagacctatttctctacctttaagaatatgtatttcagcggcgac
ggcgcgcgtcgcgatgaggacggctattactggatcaccggtcgcgtggacgacgtgtta
aacgtctccggccaccgtctgggtacggcggaaatcgagtcagcgctggtggcgcatccg
aagatcgccgaagcggcggtggtgggtattccacacgctatcaaaggccaggcgatttac
gcttatgtgacgctcaaccacggcgaggagccgtcgccagaactgtacgcggaggtgcgc
aactgggtacgtaaagagattggcccactggcgacgccggacgtgctgcactggaccgac
tcactgccaaaaacccgttccggcaaaattatgcgccgcattttgcgcaaaatcgcggcg
ggcgataccagcaatctgggcgatacctcgactctcgccgatcctggcgtggtggagaaa
ctgctcgaagagaagcaggccatcgcgatgccgtcataa

DBGET integrated database retrieval system