KEGG   Salmonella enterica subsp. enterica serovar Typhimurium 798: UMN798_4928Help
Entry
UMN798_4928       CDS       T01782                                 

Gene name
holD
Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
sef  Salmonella enterica subsp. enterica serovar Typhimurium 798
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:sef00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    UMN798_4928 (holD)
   00240 Pyrimidine metabolism
    UMN798_4928 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    UMN798_4928 (holD)
   03430 Mismatch repair
    UMN798_4928 (holD)
   03440 Homologous recombination
    UMN798_4928 (holD)
Enzymes [BR:sef01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     UMN798_4928 (holD)
DNA replication proteins [BR:sef03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     UMN798_4928 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4831049..4831486
Genome map
AA seq 145 aa AA seqDB search
MTSRRDWQLQQLGITQWALRRPGALQGEIAISLPAHVRLIVVAEELPALNEPLMRDILRA
LTVSPDQVLPLTPERVAMLPQGSRCNSWRLGTDAPLQLEGAQVTTPAFNELRANPAARAA
LWQQICEHEHDFYPQHDRSPRSLAD
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcagttacagcaactgggtattacgcagtgggcgctgcga
cgtcctggcgcgctacagggcgagattgcgatttcccttcccgcgcacgttcgtctgatc
gtggttgcagaggaattacctgcgctgaacgagccgctaatgcgcgatatcttacgcgcg
ttgaccgtgagtcccgatcaggttttaccgctgacgcctgagcgcgtcgccatgctgccg
cagggcagccgttgtaatagctggcggttaggaactgacgcgccgctccaactcgaaggc
gctcaggtcacgacgccggcgtttaatgaactccgggcaaacccggcggcacgcgccgca
ctatggcaacaaatctgcgaacatgaacacgatttctatcctcagcacgaccgatctccc
cgcagcctggcagattga

DBGET integrated database retrieval system