KEGG   Salmonella enterica subsp. enterica serovar Gallinarum 287/91: SG0089Help
Entry
SG0089            CDS       T00770                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
seg  Salmonella enterica subsp. enterica serovar Gallinarum 287/91
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:seg00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:seg00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
100548..101027
Genome map
AA seq 159 aa AA seqDB search
MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRHTWESIGRPLPGRKNI
VISSQPGTDDRVQWVKSVDEAIAACGDAPEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE
GDTHFPDYEPDDWESVFSEFHDADAQNSHSYCFEILERR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtctgattgcggcgttagcggtggatcgcgtcatcggtatggaaaacgccatg
ccgtggaacctgcctgccgatctcgcctggtttaaacgtaacacgttaaataaacctgtc
gtcatgggacgtcacacctgggagtccatcggacgccccttaccgggacgtaaaaatatt
gttatcagcagccagccaggcaccgacgatcgcgtgcagtgggtgaagtctgtcgatgag
gcgattgccgcttgcggcgatgcgccggaaattatggtcattggcggcgggcgcgtgtac
gagcagttcctgccaaaggcgcagaagctttatctgacgcatattgatgcggaagtcgaa
ggcgatacccattttccggattatgaaccggatgactgggaatcggtattcagtgagttt
cacgatgccgacgcgcagaattctcacagctattgtttcgagattctggaacgtcgttaa

DBGET integrated database retrieval system